CNOT3 Antibody (4B8) | Novus Biologicals H00004849-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

CNOT3 Antibody (4B8)

catalog :

H00004849-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4B8

reactivity :

human, mouse

application :

western blot, ELISA, immunocytochemistry, immunoprecipitation

citations: 9

Reference
Shirai Y, Mizutani A, Nishijima S, Horie M, Kikuguchi C, Elisseeva O, et al. CNOT3 targets negative cell cycle regulators in non-small cell lung cancer development. Oncogene. 2019;38:2580-2594 pubmed publisher
Yamaguchi T, Suzuki T, Sato T, Takahashi A, Watanabe H, Kadowaki A, et al. The CCR4-NOT deadenylase complex controls Atg7-dependent cell death and heart function. Sci Signal. 2018;11: pubmed publisher
Cejas P, Cavazza A, Yandava C, Moreno V, Horst D, Moreno Rubio J, et al. Transcriptional Regulator CNOT3 Defines an Aggressive Colorectal Cancer Subtype. Cancer Res. 2017;77:766-779 pubmed publisher
Zheng X, Yang P, Lackford B, Bennett B, Wang L, Li H, et al. CNOT3-Dependent mRNA Deadenylation Safeguards the Pluripotent State. Stem Cell Reports. 2016;7:897-910 pubmed publisher
Inoue T, Morita M, Hijikata A, Fukuda Yuzawa Y, Adachi S, Isono K, et al. CNOT3 contributes to early B cell development by controlling Igh rearrangement and p53 mRNA stability. J Exp Med. 2015;212:1465-79 pubmed publisher
Kamon M, Katano M, Hiraki Kamon K, Hishida T, Nakachi Y, Mizuno Y, et al. Identification of Ccr4-not complex components as regulators of transition from partial to genuine induced pluripotent stem cells. Stem Cells Dev. 2014;23:2170-9 pubmed publisher
Doidge R, Mittal S, Aslam A, Winkler G. The anti-proliferative activity of BTG/TOB proteins is mediated via the Caf1a (CNOT7) and Caf1b (CNOT8) deadenylase subunits of the Ccr4-not complex. PLoS ONE. 2012;7:e51331 pubmed publisher
Aslam A, Mittal S, Koch F, Andrau J, Winkler G. The Ccr4-NOT deadenylase subunits CNOT7 and CNOT8 have overlapping roles and modulate cell proliferation. Mol Biol Cell. 2009;20:3840-50 pubmed publisher
Hu G, Kim J, Xu Q, Leng Y, Orkin S, Elledge S. A genome-wide RNAi screen identifies a new transcriptional module required for self-renewal. Genes Dev. 2009;23:837-48 pubmed publisher

product information

brand :

Novus

master code :

H00004849-M01

SKU :

H00004849-M01

product name :

CNOT3 Antibody (4B8)

description :

The CNOT3 Antibody (4B8) from Novus Biologicals is a mouse monoclonal antibody to CNOT3. This antibody reacts with human, mouse. The CNOT3 Antibody (4B8) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation.

target :

CNOT3

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

4B8

conjugate :

Unconjugated

host :

Mouse

immunogen :

MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANAN
QKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLI
DNRKLIETQMERFKVVERETKT
CNOT3 (NP_055331, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human, Mouse

specificity :

CNOT3 - CCR4-NOT transcription complex, subunit 3

gene symbol :

CNOT3

catalog number base :

H00004849-M01

accessionNumbers :

NP_055331

applications :

Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation

2020 USD :

399

2021 USD :

399 USD

alt names :

CCR4-NOT transcription complex, subunit 3, KIAA0691CCR4-associated factor 3, LENG2yeast) homolog, Leukocyte receptor cluster member 2

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.