MYH Antibody (4D10) | Novus Biologicals H00004595-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

MYH Antibody (4D10)

catalog :

H00004595-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4D10

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

citations: 10

Reference
Eshtad S, Mavajian Z, Rudd S, Visnes T, Bostrom J, Altun M, et al. hMYH and hMTH1 cooperate for survival in mismatch repair defective T-cell acute lymphoblastic leukemia. Oncogenesis. 2016;5:e275 pubmed publisher
Shinmura K, Kato H, Kawanishi Y, Yoshimura K, Igarashi H, Goto M, et al. Reduced expression of the DNA glycosylase gene MUTYH is associated with an increased number of somatic mutations via a reduction in the DNA repair capacity in prostate adenocarcinoma. Mol Carcinog. 2017;56:781-788 pubmed publisher
Komine K, Shimodaira H, Takao M, Soeda H, Zhang X, Takahashi M, et al. Functional Complementation Assay for 47 MUTYH Variants in a MutY-Disrupted Escherichia coli Strain. Hum Mutat. 2015;36:704-11 pubmed publisher
Agustina L, Hahm S, Han S, Tran A, Chung J, Park J, et al. Visualization of the physical and functional interaction between hMYH and hRad9 by Dronpa bimolecular fluorescence complementation. BMC Mol Biol. 2014;15:17 pubmed publisher
Shinmura K, Goto M, Tao H, Kato H, Suzuki R, Nakamura S, et al. Impaired 8-hydroxyguanine repair activity of MUTYH variant p.Arg109Trp found in a Japanese patient with early-onset colorectal cancer. Oxid Med Cell Longev. 2014;2014:617351 pubmed publisher
Hahm S, Chung J, Agustina L, Han S, Yoon I, Park J, et al. Human MutY homolog induces apoptosis in etoposide-treated HEK293 cells. Oncol Lett. 2012;4:1203-1208 pubmed
Raetz A, Xie Y, Kundu S, Brinkmeyer M, Chang C, David S. Cancer-associated variants and a common polymorphism of MUTYH exhibit reduced repair of oxidative DNA damage using a GFP-based assay in mammalian cells. Carcinogenesis. 2012;33:2301-9 pubmed publisher
Shinmura K, Goto M, Suzuki M, Tao H, Yamada H, Igarashi H, et al. Reduced expression of MUTYH with suppressive activity against mutations caused by 8-hydroxyguanine is a novel predictor of a poor prognosis in human gastric cancer. J Pathol. 2011;225:414-23 pubmed publisher
Suzuki T, Harashima H, Kamiya H. Effects of base excision repair proteins on mutagenesis by 8-oxo-7,8-dihydroguanine (8-hydroxyguanine) paired with cytosine and adenine. DNA Repair (Amst). 2010;9:542-50 pubmed publisher
van der Post R, Kets C, Ligtenberg M, van Krieken J, Hoogerbrugge N. Immunohistochemistry is not an accurate first step towards the molecular diagnosis of MUTYH-associated polyposis. Virchows Arch. 2009;454:25-9 pubmed publisher

product information

brand :

Novus

master code :

H00004595-M01

SKU :

H00004595-M01

product name :

MYH Antibody (4D10)

description :

The MYH Antibody (4D10) from Novus Biologicals is a mouse monoclonal antibody to MYH. This antibody reacts with human, mouse. The MYH Antibody (4D10) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, RNA Inhibition, Sandwich ELISA.

target :

MYH

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

4D10

conjugate :

Unconjugated

host :

Mouse

immunogen :

KLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHTAAVST
AMKKVFRVYQGQQPGTCMGSKRSQVSSPCSRKKPRMGQQ
VLDNFFRSHISTDAHSLNSAAQ
MUTYH (AAH03178, 436 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human, Mouse

specificity :

MUTYH - mutY homolog (E. coli)

gene symbol :

MUTYH

catalog number base :

H00004595-M01

accessionNumbers :

AAH03178

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, RNA Inhibition, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

EC 3.2.2, EC 3.2.2.-, EC 3.2.2.31, hMYH, MGC4416, MutY homolog, MUTYH, Muyth, MYH, MYHA/G-specific adenine DNA glycosylase

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.