This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
MSH5 Antibody (1C11)
catalog :
H00004439-M08
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C11
reactivity :
human, mouse
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
citations: 1
product information
brand :
Novus
master code :
H00004439-M08
SKU :
H00004439-M08
product name :
MSH5 Antibody (1C11)
unit size :
0.1 mg
seo description :
The MSH5 Antibody (1C11) - Azide and BSA Free from Novus is a mouse monoclonal antibody to MSH5. This antibody reacts with human,mouse. The MSH5 Antibody (1C11) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
MSH5
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
1C11
conjugate :
Unconjugated
dilution :
Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
host :
Mouse
immunogen :
GNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKE
VSDLIRSGKPIKPVKDLLKKNQMENCQTLVDKFMKLDLE
DPNLDLNVFMSQEVLPAATSIL
MSH5 (AAH02498, 736 a.a. ~ 835 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
VSDLIRSGKPIKPVKDLLKKNQMENCQTLVDKFMKLDLE
DPNLDLNVFMSQEVLPAATSIL
MSH5 (AAH02498, 736 a.a. ~ 835 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human,Mouse
specificity :
mutS homolog 5 (E
gene symbol :
MSH5
accessionNumbers :
AAH02498
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
DKFZp434C1615, G7, hMSH5, MGC2939, mutS (E. coli) homolog 5, mutS homolog 5 (E. coli), mutS protein homolog 5, MUTSH5, NG23
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
