MMR/CD206/Mannose Receptor Antibody (5C11) | Novus Biologicals H00004360-M02 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

MMR/CD206/Mannose Receptor Antibody (5C11)

catalog :

H00004360-M02

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

5C11

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

citations: 16

Reference
Numaguchi R, Furuhashi M, Matsumoto M, Sato H, Yanase Y, Kuroda Y, et al. Differential Phenotypes in Perivascular Adipose Tissue Surrounding the Internal Thoracic Artery and Diseased Coronary Artery. J Am Heart Assoc. 2019;8:e011147 pubmed publisher
Ko A, Kang G, Hattler J, Galadima H, Zhang J, Li Q, et al. Macrophages but not Astrocytes Harbor HIV DNA in the Brains of HIV-1-Infected Aviremic Individuals on Suppressive Antiretroviral Therapy. J Neuroimmune Pharmacol. 2019;14:110-119 pubmed publisher
Wehrhan F, Büttner Herold M, Distel L, Ries J, Moebius P, Preidl R, et al. Galectin 3 expression in regional lymph nodes and lymph node metastases of oral squamous cell carcinomas. BMC Cancer. 2018;18:823 pubmed publisher
Weber M, Schlittenbauer T, Moebius P, Büttner Herold M, Ries J, Preidl R, et al. Macrophage polarization differs between apical granulomas, radicular cysts, and dentigerous cysts. Clin Oral Investig. 2018;22:385-394 pubmed publisher
Nakagawa T, Ohnishi K, Kosaki Y, Saito Y, Horlad H, Fujiwara Y, et al. Optimum immunohistochemical procedures for analysis of macrophages in human and mouse formalin fixed paraffin-embedded tissue samples. J Clin Exp Hematop. 2017;57:31-36 pubmed publisher
Olmes G, Büttner Herold M, Ferrazzi F, Distel L, Amann K, Daniel C. CD163+ M2c-like macrophages predominate in renal biopsies from patients with lupus nephritis. Arthritis Res Ther. 2016;18:90 pubmed publisher
Weber M, Iliopoulos C, Moebius P, BÃ¼ttner Herold M, Amann K, Ries J, et al. Prognostic significance of macrophage polarization in early stage oral squamous cell carcinomas. Oral Oncol. 2016;52:75-84 pubmed publisher
Weber M, Moebius P, BÃ¼ttner Herold M, Amann K, Preidl R, Neukam F, et al. Macrophage polarisation changes within the time between diagnostic biopsy and tumour resection in oral squamous cell carcinomas--an immunohistochemical study. Br J Cancer. 2015;113:510-9 pubmed publisher
Itano M, Graus M, Pehlke C, Wester M, Liu P, Lidke K, et al. Super-resolution imaging of C-type lectin spatial rearrangement within the dendritic cell plasma membrane at fungal microbe contact sites. Front Phys. 2014;2: pubmed
Holder G, McGary C, Johnson E, Zheng R, John V, Sugimoto C, et al. Expression of the mannose receptor CD206 in HIV and SIV encephalitis: a phenotypic switch of brain perivascular macrophages with virus infection. J Neuroimmune Pharmacol. 2014;9:716-26 pubmed publisher
Wehrhan F, Büttner Herold M, Hyckel P, Moebius P, Preidl R, Distel L, et al. Increased malignancy of oral squamous cell carcinomas (oscc) is associated with macrophage polarization in regional lymph nodes - an immunohistochemical study. BMC Cancer. 2014;14:522 pubmed publisher
Graus M, Pehlke C, Wester M, Davidson L, Steinberg S, Neumann A. A new tool to quantify receptor recruitment to cell contact sites during host-pathogen interaction. PLoS Comput Biol. 2014;10:e1003639 pubmed publisher
Weber M, Büttner Herold M, Hyckel P, Moebius P, Distel L, Ries J, et al. Small oral squamous cell carcinomas with nodal lymphogenic metastasis show increased infiltration of M2 polarized macrophages--an immunohistochemical analysis. J Craniomaxillofac Surg. 2014;42:1087-94 pubmed publisher
Canna S, Costa Reis P, Bernal W, Chu N, Sullivan K, Paessler M, et al. Brief report: alternative activation of laser-captured murine hemophagocytes. Arthritis Rheumatol. 2014;66:1666-71 pubmed
Zhuang P, Zhu M, Wang J, Zhou X, Quan Z, Shen J. Xanthogranulomatous cholecystitis: a clinicopathological study of its association with gallbladder carcinoma. J Dig Dis. 2013;14:45-50 pubmed publisher
Hirata Y, Tabata M, Kurobe H, Motoki T, Akaike M, Nishio C, et al. Coronary atherosclerosis is associated with macrophage polarization in epicardial adipose tissue. J Am Coll Cardiol. 2011;58:248-55 pubmed publisher

product information

brand :

Novus

master code :

H00004360-M02

SKU :

H00004360-M02

product name :

MMR/CD206/Mannose Receptor Antibody (5C11)

description :

The MMR/CD206/Mannose Receptor Antibody (5C11) from Novus Biologicals is a mouse monoclonal antibody to MMR/CD206/Mannose Receptor. This antibody reacts with human, fungi, monkey. The MMR/CD206/Mannose Receptor Antibody (5C11) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA.

target :

MMR/CD206/Mannose Receptor

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

5C11

conjugate :

Unconjugated

host :

Mouse

immunogen :

TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRW
VSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQK
WECKNDTLLGIKGEDLFFNYGNRQEKNIMLY
MRC1 (NP_002429, 22 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human, Fungi, Monkey

specificity :

MRC1 (5C11)

gene symbol :

MRC1

catalog number base :

H00004360-M02

accessionNumbers :

NP_002429

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

CD206, CLEC13Dmacrophage mannose receptor 1, C-type lectin domain family 13 member D, mannose receptor, C type 1, MMRCD206 antigen

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.