RAB8A Antibody (3G1) | Novus Biologicals H00004218-M02 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

RAB8A Antibody (3G1)

catalog :

H00004218-M02

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3G1

reactivity :

human, mouse, zebrafish

application :

western blot, ELISA, immunocytochemistry

citations: 8

Reference
Gonzalez Hunt C, Thacker E, Toste C, Boularand S, Deprets S, Dubois L, et al. Mitochondrial DNA damage as a potential biomarker of LRRK2 kinase activity in LRRK2 Parkinson's disease. Sci Rep. 2020;10:17293 pubmed publisher
Nichols E, Smith C. Synaptic-like Vesicles Facilitate Pioneer Axon Invasion. Curr Biol. 2019;29:2652-2664.e4 pubmed publisher
Barny I, Perrault I, Michel C, Soussan M, Goudin N, Rio M, et al. Basal exon skipping and nonsense-associated altered splicing allows bypassing complete CEP290 loss-of-function in individuals with unusually mild retinal disease. Hum Mol Genet. 2018;: pubmed publisher
Ojeda Naharros I, Gesemann M, Mateos J, Barmettler G, Forbes A, Ziegler U, et al. Loss-of-function of the ciliopathy protein Cc2d2a disorganizes the vesicle fusion machinery at the periciliary membrane and indirectly affects Rab8-trafficking in zebrafish photoreceptors. PLoS Genet. 2017;13:e1007150 pubmed publisher
Goodman L, Zallocchi M. Integrin α8 and Pcdh15 act as a complex to regulate cilia biogenesis in sensory cells. J Cell Sci. 2017;130:3698-3712 pubmed publisher
Stone R, Hayashi T, Bajimaya S, Hodges E, Takimoto T. Critical role of Rab11a-mediated recycling endosomes in the assembly of type I parainfluenza viruses. Virology. 2016;487:11-8 pubmed publisher
Hampson A, O CONNOR A, Smolenski A. Synaptotagmin-like protein 4 and Rab8 interact and increase dense granule release in platelets. J Thromb Haemost. 2013;11:161-8 pubmed publisher
Hsiao Y, Tong Z, Westfall J, Ault J, Page McCaw P, Ferland R. Ahi1, whose human ortholog is mutated in Joubert syndrome, is required for Rab8a localization, ciliogenesis and vesicle trafficking. Hum Mol Genet. 2009;18:3926-41 pubmed publisher

product information

brand :

Novus

master code :

H00004218-M02

SKU :

H00004218-M02

product name :

RAB8A Antibody (3G1)

description :

The RAB8A Antibody (3G1) from Novus Biologicals is a mouse monoclonal antibody to RAB8A. This antibody reacts with human, mouse, zebrafish. The RAB8A Antibody (3G1) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Sandwich ELISA.

target :

RAB8A

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3G1

conjugate :

Unconjugated

host :

Mouse

immunogen :

EHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIK
FMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGS
NQGVKITPDQQKRSSFFRCVLL
RAB8A (AAH02977, 108 a.a. ~ 207 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human, Mouse, Zebrafish

specificity :

RAB8A - RAB8A, member RAS oncogene family

gene symbol :

RAB8A

catalog number base :

H00004218-M02

accessionNumbers :

AAH02977

applications :

Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

mel transforming oncogene (derived from cell line NK14), mel transforming oncogene (derived from cell line NK14)- RAB8 homolog, MELras-associated protein RAB8, Oncogene c-mel, RAB8A, member RAS oncogene family, RAB8mel transforming oncogene (RAB8 homolog), ras-related protein Rab-8A

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.