NBR1 Antibody (6B11) - Azide and BSA Free | Novus Biologicals H00004077-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

NBR1 Antibody (6B11) - Azide and BSA Free

catalog :

H00004077-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6B11

reactivity :

human, mouse

application :

western blot, ELISA, immunocytochemistry

more info or order :

Novus Biologicals product webpage

citations: 19

Reference
Calcagnì A, Staiano L, Zampelli N, Minopoli N, Herz N, Di Tullio G, et al. Loss of the batten disease protein CLN3 leads to mis-trafficking of M6PR and defective autophagic-lysosomal reformation. Nat Commun. 2023;14:3911 pubmed publisher
Turco E, Savova A, Gere F, Ferrari L, Romanov J, Schuschnig M, et al. Reconstitution defines the roles of p62, NBR1 and TAX1BP1 in ubiquitin condensate formation and autophagy initiation. Nat Commun. 2021;12:5212 pubmed publisher
Chang H, Tao R, Tan C, Wu Y, Bay B, Yu V. The BAX-binding protein MOAP1 associates with LC3 and promotes closure of the phagophore. Autophagy. 2021;:1-15 pubmed publisher
Tan C, Chang H, Zhou Q, Yu C, Fu N, Sabapathy K, et al. MOAP-1-mediated dissociation of p62/SQSTM1 bodies releases Keap1 and suppresses Nrf2 signaling. EMBO Rep. 2021;:e50854 pubmed publisher
Monaco A, Maffia V, Sorrentino N, Sambri I, Ezhova Y, Giuliano T, et al. The Amyloid Inhibitor CLR01 Relieves Autophagy and Ameliorates Neuropathology in a Severe Lysosomal Storage Disease. Mol Ther. 2020;28:1167-1176 pubmed publisher
Park S, Zuber C, Roth J. Selective autophagy of cytosolic protein aggregates involves ribosome-free rough endoplasmic reticulum. Histochem Cell Biol. 2020;153:89-99 pubmed publisher
Riccio V, Demers N, Hua R, Vissa M, Cheng D, Strilchuk A, et al. Deubiquitinating enzyme USP30 maintains basal peroxisome abundance by regulating pexophagy. J Cell Biol. 2019;218:798-807 pubmed publisher
Cai J, Pires K, Ferhat M, Chaurasia B, Buffolo M, Smalling R, et al. Autophagy Ablation in Adipocytes Induces Insulin Resistance and Reveals Roles for Lipid Peroxide and Nrf2 Signaling in Adipose-Liver Crosstalk. Cell Rep. 2018;25:1708-1717.e5 pubmed publisher
Fiesel F, James E, Hudec R, Springer W. Mitochondrial targeted HSP90 inhibitor Gamitrinib-TPP (G-TPP) induces PINK1/Parkin-dependent mitophagy. Oncotarget. 2017;8:106233-106248 pubmed publisher
Jiang L, Hara Kuge S, Yamashita S, Fujiki Y. Peroxin Pex14p is the key component for coordinated autophagic degradation of mammalian peroxisomes by direct binding to LC3-II. Genes Cells. 2015;20:36-49 pubmed publisher
Dowdle W, Nyfeler B, Nagel J, Elling R, Liu S, Triantafellow E, et al. Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo. Nat Cell Biol. 2014;16:1069-79 pubmed publisher
Nicot A, Lo Verso F, Ratti F, Pilot Storck F, Streichenberger N, Sandri M, et al. Phosphorylation of NBR1 by GSK3 modulates protein aggregation. Autophagy. 2014;10:1036-53 pubmed publisher
Park S, Jang I, Zuber C, Lee Y, Cho J, Matsuo I, et al. ERADication of EDEM1 occurs by selective autophagy and requires deglycosylation by cytoplasmic peptide N-glycanase. Histochem Cell Biol. 2014;142:153-69 pubmed publisher
Micsenyi M, Sikora J, Stephney G, Dobrenis K, Walkley S. Lysosomal membrane permeability stimulates protein aggregate formation in neurons of a lysosomal disease. J Neurosci. 2013;33:10815-27 pubmed publisher
Rue L, López Soop G, Gelpi E, Martinez Vicente M, Alberch J, Pérez Navarro E. Brain region- and age-dependent dysregulation of p62 and NBR1 in a mouse model of Huntington's disease. Neurobiol Dis. 2013;52:219-28 pubmed publisher
Deosaran E, Larsen K, Hua R, Sargent G, Wang Y, Kim S, et al. NBR1 acts as an autophagy receptor for peroxisomes. J Cell Sci. 2013;126:939-52 pubmed publisher
Wong E, Bejarano E, Rakshit M, Lee K, Hanson H, Zaarur N, et al. Molecular determinants of selective clearance of protein inclusions by autophagy. Nat Commun. 2012;3:1240 pubmed publisher
Mardakheh F, Auciello G, Dafforn T, Rappoport J, Heath J. Nbr1 is a novel inhibitor of ligand-mediated receptor tyrosine kinase degradation. Mol Cell Biol. 2010;30:5672-85 pubmed publisher
Mardakheh F, Yekezare M, Machesky L, Heath J. Spred2 interaction with the late endosomal protein NBR1 down-regulates fibroblast growth factor receptor signaling. J Cell Biol. 2009;187:265-77 pubmed publisher

product information

master code :

H00004077-M01

SKU :

H00004077-M01

product name :

NBR1 Antibody (6B11) - Azide and BSA Free

unit size :

0.1 mg

description :

The NBR1 Antibody (6B11) - Azide and BSA Free from Novus is a mouse monoclonal antibody to NBR1. This antibody reacts with human,mouse. The NBR1 Antibody (6B11) - Azide and BSA Free has been validated for the following applications: Western Blot,Electron Microscopy,Immunocytochemistry/ Immunofluorescence,ELISA,Simple Western.

target :

NBR1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

6B11

conjugate :

Unconjugated

host :

Mouse

immunogen :

EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFD
LNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQ
MQVHEGHHVVDEAPPPV
NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human,Mouse

specificity :

NBR1 - neighbor of BRCA1 gene 1 (6B11)

gene symbol :

NBR1

accessionNumbers :

NP_005890

applications :

Western Blot,Electron Microscopy,Immunocytochemistry/ Immunofluorescence,ELISA,Simple Western

USD :

529 USD

alt names :

Cell migration-inducing gene 19 protein, FLJ98272, KIAA0049CA125, M17S2FLJ55359,1A1-3B, Membrane component chromosome 17 surface marker 2,1A13B, membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigenCA125), migration-inducing protein 19, neighbor of BRCA1 gene 1, Neighbor of BRCA1 gene 1 protein, next to BRCA1 gene 1 protein, Protein 1A1-3B

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage