SH2D1A Antibody (1C9) - Azide and BSA Free | Novus Biologicals H00004068-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SH2D1A Antibody (1C9) - Azide and BSA Free

catalog :

H00004068-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1C9

reactivity :

human, mouse

application :

western blot, ELISA, flow cytometry

more info or order :

Novus Biologicals product webpage

citations: 9

Reference
Houghton B, Panchal N, Haas S, Chmielewski K, Hildenbeutel M, Whittaker T, et al. Genome Editing With TALEN, CRISPR-Cas9 and CRISPR-Cas12a in Combination With AAV6 Homology Donor Restores T Cell Function for XLP. Front Genome Ed. 2022;4:828489 pubmed publisher
Khanolkar A, Wilks J, Liu G, Caparelli E, De Moura M, Yap K, et al. Detailed Phenotypic and Functional Characterization of a Rare, Antibody-Dependent SLAM-Associated Protein Expression Pattern. Immunohorizons. 2020;4:153-164 pubmed publisher
Panchal N, Houghton B, Díez B, Ghosh S, Ricciardelli I, Thrasher A, et al. Transfer of gene-corrected T cells corrects humoral and cytotoxic defects in patients with X-linked lymphoproliferative disease. J Allergy Clin Immunol. 2018;142:235-245.e6 pubmed publisher
Cetica V, Sieni E, Pende D, Danesino C, De Fusco C, Locatelli F, et al. Genetic predisposition to hemophagocytic lymphohistiocytosis: Report on 500 patients from the Italian registry. J Allergy Clin Immunol. 2016;137:188-196.e4 pubmed publisher
Meazza R, Tuberosa C, Cetica V, Falco M, Parolini S, Grieve S, et al. Diagnosing XLP1 in patients with hemophagocytic lymphohistiocytosis. J Allergy Clin Immunol. 2014;134:1381-1387.e7 pubmed publisher
Menard L, Cantaert T, Chamberlain N, Tangye S, Riminton S, Church J, et al. Signaling lymphocytic activation molecule (SLAM)/SLAM-associated protein pathway regulates human B-cell tolerance. J Allergy Clin Immunol. 2014;133:1149-61 pubmed publisher
Palendira U, Low C, Bell A, Ma C, Abbott R, Phan T, et al. Expansion of somatically reverted memory CD8+ T cells in patients with X-linked lymphoproliferative disease caused by selective pressure from Epstein-Barr virus. J Exp Med. 2012;209:913-24 pubmed publisher
Palendira U, Low C, Chan A, Hislop A, Ho E, Phan T, et al. Molecular pathogenesis of EBV susceptibility in XLP as revealed by analysis of female carriers with heterozygous expression of SAP. PLoS Biol. 2011;9:e1001187 pubmed publisher
Ma C, Suryani S, Avery D, Chan A, Nanan R, Santner Nanan B, et al. Early commitment of naïve human CD4(+) T cells to the T follicular helper (T(FH)) cell lineage is induced by IL-12. Immunol Cell Biol. 2009;87:590-600 pubmed publisher

product information

master code :

H00004068-M01

SKU :

H00004068-M01

product name :

SH2D1A Antibody (1C9) - Azide and BSA Free

unit size :

0.1 mg

description :

The SH2D1A Antibody (1C9) - Azide and BSA Free from Novus is a mouse monoclonal antibody to SH2D1A. This antibody reacts with human,mouse. The SH2D1A Antibody (1C9) - Azide and BSA Free has been validated for the following applications: Flow Cytometry,ELISA,Western Blot,Functional.

target :

SH2D1A

category :

Primary Antibodies

buffer :

PBS, pH 7.4

clonality :

Monoclonal

clone :

1C9

conjugate :

Unconjugated

host :

Mouse

immunogen :

MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPG
VYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFR
KIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGI
REDPDVCLKAP
SH2D1A (AAH20732, 1 a.a. ~ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Mouse

specificity :

SH2D1A - SH2 domain protein 1A, Duncan's disease (lymphoproliferative syndrome)

gene symbol :

SH2D1A

accessionNumbers :

AAH20732

applications :

Flow Cytometry,ELISA,Western Blot,Functional

USD :

529 USD

alt names :

DSHPLYP, Duncan disease SH2-protein, EBVS, FLJ92177, IMD5, MTCP1, SAP/SH2D1A, SAPlymphoproliferative syndrome, SH2 domain containing 1A, SH2 domain-containing protein 1A, signaling lymphocyte activation molecule-associated protein, Signaling lymphocytic activation molecule-associated protein, SLAM associated protein/SH2 domain protein 1A, SLAM-associated protein, T cell signal transduction molecule SAP, T-cell signal transduction molecule SAP, XLPDFLJ18687, XLPSH2 domain protein 1A

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage