Lysyl Oxidase Homolog 2/LOXL2 Antibody (5D2) - Azide and BSA Free | Novus Biologicals H00004017-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Lysyl Oxidase Homolog 2/LOXL2 Antibody (5D2) - Azide and BSA Free

catalog :

H00004017-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

5D2

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Umana Diaz C, Pichol Thievend C, Marchand M, Atlas Y, Salza R, Malbouyres M, et al. Scavenger Receptor Cysteine-Rich domains of Lysyl Oxidase-Like2 regulate endothelial ECM and angiogenesis through non-catalytic scaffolding mechanisms. Matrix Biol. 2020;88:33-52 pubmed publisher
Schmelzer C, Heinz A, Troilo H, Lockhart Cairns M, Jowitt T, Marchand M, et al. Lysyl oxidase-like 2 (LOXL2)-mediated cross-linking of tropoelastin. FASEB J. 2019;33:5468-5481 pubmed publisher
Zhan X, Jiao J, Zhang H, Li C, Zhao J, Liao L, et al. A three-gene signature from protein-protein interaction network of LOXL2- and actin-related proteins for esophageal squamous cell carcinoma prognosis. Cancer Med. 2017;6:1707-1719 pubmed publisher
Li T, Xu L, Wu Z, Liao L, SHEN J, Xu X, et al. Reduced nuclear and ectopic cytoplasmic expression of lysyl oxidase-like 2 is associated with lymph node metastasis and poor prognosis in esophageal squamous cell carcinoma. Hum Pathol. 2012;43:1068-76 pubmed publisher
Li T, Li D, Cheng L, Wu H, Gao Z, Liu Z, et al. Epithelial-mesenchymal transition induced by hepatitis C virus core protein in cholangiocarcinoma. Ann Surg Oncol. 2010;17:1937-44 pubmed publisher
Fujimoto E, Tajima S. Reciprocal regulation of LOX and LOXL2 expression during cell adhesion and terminal differentiation in epidermal keratinocytes. J Dermatol Sci. 2009;55:91-8 pubmed publisher

product information

master code :

H00004017-M01

SKU :

H00004017-M01

product name :

Lysyl Oxidase Homolog 2/LOXL2 Antibody (5D2) - Azide and BSA Free

unit size :

0.1 mg

description :

The Lysyl Oxidase Homolog 2/LOXL2 Antibody (5D2) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Lysyl Oxidase Homolog 2/LOXL2. This antibody reacts with human,mouse. The Lysyl Oxidase Homolog 2/LOXL2 Antibody (5D2) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence.

target :

Lysyl Oxidase Homolog 2/LOXL2

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

5D2

conjugate :

Unconjugated

host :

Mouse

immunogen :

NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVV
INPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSF
SEETEKKFEHFSGLLNNQLSP
LOXL2 (NP_002309, 675 a.a. ~ 773 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2b Kappa

purity :

IgG purified

species :

Human,Mouse

specificity :

LOXL2 - lysyl oxidase-like 2

gene symbol :

LOXL2

accessionNumbers :

NP_002309

applications :

ELISA,Immunohistochemistry,Western Blot,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

EC 1.4.3, EC 1.4.3.-, LOR2, lysyl oxidase homolog 2, lysyl oxidase related 2, lysyl oxidase-like 2, Lysyl oxidase-like protein 2, Lysyl oxidase-related protein 2, Lysyl oxidase-related protein WS9-14, WS9-14

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage