LETM1 Antibody (6F7) - Azide and BSA Free | Novus Biologicals H00003954-M03 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

LETM1 Antibody (6F7) - Azide and BSA Free

catalog :

H00003954-M03

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6F7

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 12

Reference
Tran Q, Lee H, Jung J, Chang S, Shrestha R, Kong G, et al. Emerging role of LETM1/GRP78 axis in lung cancer. Cell Death Dis. 2022;13:543 pubmed publisher
Morioka E, Kasuga Y, Kanda Y, Moritama S, Koizumi H, Yoshikawa T, et al. Mitochondrial LETM1 drives ionic and molecular clock rhythms in circadian pacemaker neurons. Cell Rep. 2022;39:110787 pubmed publisher
Nakamura S, Matsui A, Akabane S, Tamura Y, Hatano A, Miyano Y, et al. The mitochondrial inner membrane protein LETM1 modulates cristae organization through its LETM domain. Commun Biol. 2020;3:99 pubmed publisher
Piao L, Feng Y, Yang Z, Qi W, Li H, Han H, et al. LETM1 is a potential cancer stem-like cell marker and predicts poor prognosis in colorectal adenocarcinoma. Pathol Res Pract. 2019;215:152437 pubmed publisher
Yang Z, Ni W, Cui C, Qi W, Piao L, Xuan Y. Identification of LETM1 as a marker of cancer stem-like cells and predictor of poor prognosis in esophageal squamous cell carcinoma. Hum Pathol. 2018;81:148-156 pubmed publisher
Li N, Zheng Y, Xuan C, Lin Z, Piao L, Liu S. LETM1 overexpression is correlated with the clinical features and survival outcome of breast cancer. Int J Clin Exp Pathol. 2015;8:12893-900 pubmed
Doonan P, Chandramoorthy H, Hoffman N, Zhang X, Cardenas C, Shanmughapriya S, et al. LETM1-dependent mitochondrial Ca2+ flux modulates cellular bioenergetics and proliferation. FASEB J. 2014;28:4936-49 pubmed publisher
Chen L, Yang Y, Liu S, Piao L, Zhang Y, Lin Z, et al. High expression of leucine zipper-EF-hand containing transmembrane protein 1 predicts poor prognosis in head and neck squamous cell carcinoma. Biomed Res Int. 2014;2014:850316 pubmed publisher
Shin J, Chung Y, Kang B, Jiang H, Yu D, Han K, et al. Co-delivery of LETM1 and CTMP synergistically inhibits tumor growth in H-ras12V liver cancer model mice. Cancer Gene Ther. 2013;20:186-94 pubmed publisher
Piao L, Li Y, Kim S, Byun H, Huang S, Hwang S, et al. Association of LETM1 and MRPL36 contributes to the regulation of mitochondrial ATP production and necrotic cell death. Cancer Res. 2009;69:3397-404 pubmed publisher
Piao L, Li Y, Kim S, Sohn K, Yang K, Park K, et al. Regulation of OPA1-mediated mitochondrial fusion by leucine zipper/EF-hand-containing transmembrane protein-1 plays a role in apoptosis. Cell Signal. 2009;21:767-77 pubmed publisher
Dimmer K, Navoni F, Casarin A, Trevisson E, Endele S, Winterpacht A, et al. LETM1, deleted in Wolf-Hirschhorn syndrome is required for normal mitochondrial morphology and cellular viability. Hum Mol Genet. 2008;17:201-14 pubmed

product information

master code :

H00003954-M03

SKU :

H00003954-M03

product name :

LETM1 Antibody (6F7) - Azide and BSA Free

unit size :

0.1 mg

description :

The LETM1 Antibody (6F7) - Azide and BSA Free from Novus is a mouse monoclonal antibody to LETM1. This antibody reacts with human,mouse. The LETM1 Antibody (6F7) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Functional,Immunocytochemistry/ Immunofluorescence.

target :

LETM1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

6F7

conjugate :

Unconjugated

host :

Mouse

immunogen :

ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPAN
GMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDEN
KDGKVNIDDLVKVIELVDKEDVHISTSQVA
LETM1 (NP_036450, 601 a.a. ~ 708 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human,Mouse

specificity :

LETM1 - leucine zipper-EF-hand containing transmembrane protein 1

gene symbol :

LETM1

accessionNumbers :

NP_036450

applications :

ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Functional,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

LETM1 and EF-hand domain-containing protein 1, mitochondrial, leucine zipper-EF-hand containing transmembrane protein 1, Leucine zipper-EF-hand-containing transmembrane protein 1, Mdm38 homolog

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage