Laminin alpha 5 Antibody (2F7) - Azide and BSA Free | Novus Biologicals H00003911-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Laminin alpha 5 Antibody (2F7) - Azide and BSA Free

catalog :

H00003911-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2F7

reactivity :

human, mouse

application :

western blot, ELISA, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Tay H, André H, Chrysostomou V, Adusumalli S, Guo J, Ren X, et al. Photoreceptor laminin drives differentiation of human pluripotent stem cells to photoreceptor progenitors that partially restore retina function. Mol Ther. 2023;31:825-846 pubmed publisher
Evans R, Flores Borja F, Nassiri S, Miranda E, Lawler K, Grigoriadis A, et al. Integrin-Mediated Macrophage Adhesion Promotes Lymphovascular Dissemination in Breast Cancer. Cell Rep. 2019;27:1967-1978.e4 pubmed publisher
Lee S, Mehta S, Erickson D. Two-Color Lateral Flow Assay for Multiplex Detection of Causative Agents Behind Acute Febrile Illnesses. Anal Chem. 2016;88:8359-63 pubmed publisher
Little G, Noushmehr H, Baniwal S, Berman B, Coetzee G, Frenkel B. Genome-wide Runx2 occupancy in prostate cancer cells suggests a role in regulating secretion. Nucleic Acids Res. 2012;40:3538-47 pubmed publisher
Oikawa Y, Hansson J, Sasaki T, Rousselle P, Domogatskaya A, Rodin S, et al. Melanoma cells produce multiple laminin isoforms and strongly migrate on ?5 laminin(s) via several integrin receptors. Exp Cell Res. 2011;317:1119-33 pubmed publisher
Wu H, Chang Y, Chang Y, Liao P. Proteomics analysis of nasopharyngeal carcinoma cell secretome using a hollow fiber culture system and mass spectrometry. J Proteome Res. 2009;8:380-9 pubmed publisher
Maynard D, Heijnen H, Horne M, White J, Gahl W. Proteomic analysis of platelet alpha-granules using mass spectrometry. J Thromb Haemost. 2007;5:1945-55 pubmed

product information

master code :

H00003911-M01

SKU :

H00003911-M01

product name :

Laminin alpha 5 Antibody (2F7) - Azide and BSA Free

unit size :

0.1 mg

description :

The Laminin alpha 5 Antibody (2F7) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Laminin alpha 5. This antibody reacts with human,mouse. The Laminin alpha 5 Antibody (2F7) - Azide and BSA Free has been validated for the following applications: Immunocytochemistry/ Immunofluorescence,Western Blot,Immunohistochemistry-Paraffin,ELISA.

target :

Laminin alpha 5

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

2F7

conjugate :

Unconjugated

host :

Mouse

immunogen :

MGVSLRDKKVHWVYQLGEAGPAVLSIDEDIGEQFAAVSL
DRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPD
DFVFYVGGYPSTFTPPPLLRFP
LAMA5 (AAH03355.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human,Mouse

specificity :

LAMA5 - laminin, alpha 5

gene symbol :

LAMA5

applications :

Immunocytochemistry/ Immunofluorescence,Western Blot,Immunohistochemistry-Paraffin,ELISA

USD :

529 USD

alt names :

KIAA0533, KIAA1907, laminin alpha-5 chain, laminin subunit alpha-5, laminin, alpha 5, Laminin-10 subunit alpha, Laminin-11 subunit alpha, Laminin-15 subunit alpha

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage