Laminin alpha 2 Antibody (2D4) - Azide and BSA Free | Novus Biologicals H00003908-M01-50ug product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Laminin alpha 2 Antibody (2D4) - Azide and BSA Free

catalog :

H00003908-M01-50ug

quantity :

50 ug

price :

519 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2D4

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Amani V, Riemondy K, Fu R, Griesinger A, Grimaldo E, de Sousa G, et al. Integration of single-nuclei RNA-sequencing, spatial transcriptomics and histochemistry defines the complex microenvironment of NF1-associated plexiform neurofibromas. Acta Neuropathol Commun. 2023;11:158 pubmed publisher
de Sousa G, Lira R, de Almeida Magalh xe3 es T, da Silva K, Nagano L, Saggioro F, et al. A coordinated approach for the assessment of molecular subgroups in pediatric ependymomas using low-cost methods. J Mol Med (Berl). 2021;99:1101-1113 pubmed publisher
Sasaki A, Hirato J, Hirose T, Fukuoka K, Kanemura Y, Hashimoto N, et al. Review of ependymomas: assessment of consensus in pathological diagnosis and correlations with genetic profiles and outcome. Brain Tumor Pathol. 2019;36:92-101 pubmed publisher
Araki A, Chocholous M, Gojo J, Dorfer C, Czech T, Heinzl H, et al. Chromosome 1q gain and tenascin-C expression are candidate markers to define different risk groups in pediatric posterior fossa ependymoma. Acta Neuropathol Commun. 2016;4:88 pubmed publisher
Zakrzewska M, Fendler W, Zakrzewski K, Sikorska B, Grajkowska W, Dembowska Baginska B, et al. Altered MicroRNA Expression Is Associated with Tumor Grade, Molecular Background and Outcome in Childhood Infratentorial Ependymoma. PLoS ONE. 2016;11:e0158464 pubmed publisher
Dong H, Ding H, Young K, Blaivas M, Christensen P, Wang M. Advanced intimal hyperplasia without luminal narrowing of leptomeningeal arteries in CADASIL. Stroke. 2013;44:1456-8 pubmed publisher
Lemons J, Feng X, Bennett B, Legesse Miller A, Johnson E, Raitman I, et al. Quiescent fibroblasts exhibit high metabolic activity. PLoS Biol. 2010;8:e1000514 pubmed publisher

product information

master code :

H00003908-M01

SKU :

H00003908-M01-50ug

product name :

Laminin alpha 2 Antibody (2D4) - Azide and BSA Free

unit size :

50 ug

description :

The Laminin alpha 2 Antibody (2D4) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Laminin alpha 2. This antibody reacts with human. The Laminin alpha 2 Antibody (2D4) - Azide and BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin,IF/IHC,ELISA,Western Blot,Sandwich ELISA.

target :

Laminin alpha 2

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

2D4

conjugate :

Unconjugated

host :

Mouse

immunogen :

DAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSP
NPASTSADTNDPVFVGGFPDDLKQFGLTTSIPFRGCIRS
LKLTKGTGKPLEVNFAKALELRGVQPVSCPAN
LAMA2 (NP_000417, 3013 a.a. ~ 3122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human

specificity :

LAMA2 - laminin, alpha 2 (merosin, congenital muscular dystrophy)

gene symbol :

LAMA2

accessionNumbers :

NP_000417

applications :

Immunohistochemistry,Immunohistochemistry-Paraffin,IF/IHC,ELISA,Western Blot,Sandwich ELISA

USD :

519 USD

alt names :

Laminin M chain, laminin subunit alpha-2, laminin, alpha 2, Laminin-12 subunit alpha, Laminin-2 subunit alpha, LAMMLaminin-4 subunit alpha, Merosin heavy chain

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage