Islet-1 Antibody (2E7) - Azide and BSA Free | Novus Biologicals H00003670-M05 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Islet-1 Antibody (2E7) - Azide and BSA Free

catalog :

H00003670-M05

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2.00E+07

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunocytochemistry, immunoprecipitation, chromatin immunoprecipitation

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Shi Q, Ni X, Lei M, Xia Q, Dong Y, Zhang Q, et al. Phosphorylation of islet-1 serine 269 by CDK1 increases its transcriptional activity and promotes cell proliferation in gastric cancer. Mol Med. 2021;27:47 pubmed publisher
Tian Y, Wang W, Lu Q, Chen P, Ma K, Jia Z, et al. Cross-talk of SFRP4, integrin ?1?1, and Notch1 inhibits cardiac differentiation of P19CL6 cells. Cell Signal. 2016;28:1806-15 pubmed publisher
Lizio M, Ishizu Y, Itoh M, Lassmann T, Hasegawa A, Kubosaki A, et al. Mapping Mammalian Cell-type-specific Transcriptional Regulatory Networks Using KD-CAGE and ChIP-seq Data in the TC-YIK Cell Line. Front Genet. 2015;6:331 pubmed publisher
Yang Z, Zhang Q, Lu Q, Jia Z, Chen P, Ma K, et al. ISL-1 promotes pancreatic islet cell proliferation by forming an ISL-1/Set7/9/PDX-1 complex. Cell Cycle. 2015;14:3820-9 pubmed publisher
Zhang Q, Yang Z, Jia Z, Liu C, Guo C, Lu H, et al. ISL-1 is overexpressed in non-Hodgkin lymphoma and promotes lymphoma cell proliferation by forming a p-STAT3/p-c-Jun/ISL-1 complex. Mol Cancer. 2014;13:181 pubmed publisher
Zhang Q, Yang Z, Wang W, Guo T, Jia Z, Ma K, et al. A positive feedback regulation of ISL-1 in DLBCL but not in pancreatic ?-cells. Biochem Biophys Res Commun. 2014;449:295-300 pubmed publisher
Li B, Jia Z, Wang T, Wang W, Zhang C, Chen P, et al. Interaction of Wnt/?-catenin and notch signaling in the early stage of cardiac differentiation of P19CL6 cells. J Cell Biochem. 2012;113:629-39 pubmed publisher
Guo T, Wang W, Zhang H, Liu Y, Chen P, Ma K, et al. ISL1 promotes pancreatic islet cell proliferation. PLoS ONE. 2011;6:e22387 pubmed publisher

product information

master code :

H00003670-M05

SKU :

H00003670-M05

product name :

Islet-1 Antibody (2E7) - Azide and BSA Free

unit size :

0.1 mg

description :

The Islet-1 Antibody (2E7) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Islet-1. This antibody reacts with human,mouse,rat. The Islet-1 Antibody (2E7) - Azide and BSA Free has been validated for the following applications: Chemotaxis,Immunoprecipitation,Western Blot,ELISA,Functional,Chromatin Immunoprecipitation (ChIP),Immunocytochemistry/ Immunofluorescence.

target :

Islet-1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

2.00E+07

conjugate :

Unconjugated

host :

Mouse

immunogen :

YCKRDYIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIEC
FRCVACSRQLIPGDEFALREDGLFCRADHDVVERASLGA
GDPLSPLHPARPLQMAAEP
ISL1 (NP_002193, 63 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Mouse,Rat

specificity :

ISL1 - ISL1 transcription factor, LIM/homeodomain, (islet-1)

gene symbol :

ISL1

accessionNumbers :

NP_002193

applications :

Chemotaxis,Immunoprecipitation,Western Blot,ELISA,Functional,Chromatin Immunoprecipitation (ChIP),Immunocytochemistry/ Immunofluorescence

USD :

499 USD

alt names :

insulin gene enhancer protein ISL-1, ISL LIM homeobox 1, Isl-1, ISL1 transcription factor, LIM/homeodomain, ISL1 transcription factor, LIM/homeodomain, (islet-1), Islet-1, ISLET1

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage