SHIP2/INPPL1 Antibody (3E6) - Azide and BSA Free | Novus Biologicals H00003636-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SHIP2/INPPL1 Antibody (3E6) - Azide and BSA Free

catalog :

H00003636-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3.00E+06

reactivity :

human

application :

western blot, ELISA, immunocytochemistry

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Ando K, K xfc xe7 xfc kali F, Doeraene E, Nagaraj S, Antonelli E, Thazin Htut M, et al. Alteration of gene expression and protein solubility of the PI 5-phosphatase SHIP2 are correlated with Alzheimer's disease pathology progression. Acta Neuropathol. 2024;147:94 pubmed publisher
Antoine M, Vandenbroere I, Ghosh S, Erneux C, Pirson I. IRSp53 is a novel interactor of SHIP2: A role of the actin binding protein Mena in their cellular localization in breast cancer cells. Cell Signal. 2020;73:109692 pubmed publisher
Ramos A, Ghosh S, Suhel T, Chevalier C, Obeng E, Fafilek B, et al. Phosphoinositide 5-phosphatases SKIP and SHIP2 in ruffles, the endoplasmic reticulum and the nucleus: An update. Adv Biol Regul. 2020;75:100660 pubmed publisher
Ramos A, Ghosh S, Dedobbeleer M, Robe P, Rogister B, Erneux C. Lipid phosphatases SKIP and SHIP2 regulate fibronectin-dependent cell migration in glioblastoma. FEBS J. 2019;286:1120-1135 pubmed publisher
Ramos A, Ghosh S, Erneux C. The impact of phosphoinositide 5-phosphatases on phosphoinositides in cell function and human disease. J Lipid Res. 2019;60:276-286 pubmed publisher
Chan Wah Hak L, Khan S, Di Meglio I, Law A, Lucken Ardjomande Häsler S, Quintaneiro L, et al. FBP17 and CIP4 recruit SHIP2 and lamellipodin to prime the plasma membrane for fast endophilin-mediated endocytosis. Nat Cell Biol. 2018;20:1023-1031 pubmed publisher
Edimo W, Ramos A, Ghosh S, Vanderwinden J, Erneux C. The SHIP2 interactor Myo1c is required for cell migration in 1321 N1 glioblastoma cells. Biochem Biophys Res Commun. 2016;476:508-514 pubmed publisher
Elong Edimo W, Ghosh S, Derua R, Janssens V, Waelkens E, Vanderwinden J, et al. SHIP2 controls plasma membrane PI(4,5)P2 thereby participating in the control of cell migration in 1321 N1 glioblastoma cells. J Cell Sci. 2016;129:1101-14 pubmed publisher
Deneubourg L, Elong Edimo W, Moreau C, Vanderwinden J, Erneux C. Phosphorylated SHIP2 on Y1135 localizes at focal adhesions and at the mitotic spindle in cancer cell lines. Cell Signal. 2014;26:1193-203 pubmed publisher
Elong Edimo W, Vanderwinden J, Erneux C. SHIP2 signalling at the plasma membrane, in the nucleus and at focal contacts. Adv Biol Regul. 2013;53:28-37 pubmed publisher
McNulty S, Powell K, Erneux C, Kalman D. The host phosphoinositide 5-phosphatase SHIP2 regulates dissemination of vaccinia virus. J Virol. 2011;85:7402-10 pubmed publisher

product information

master code :

H00003636-M01

SKU :

H00003636-M01

product name :

SHIP2/INPPL1 Antibody (3E6) - Azide and BSA Free

unit size :

0.1 mg

description :

The SHIP2/INPPL1 Antibody (3E6) - Azide and BSA Free from Novus is a mouse monoclonal antibody to SHIP2/INPPL1. This antibody reacts with human,monkey. The SHIP2/INPPL1 Antibody (3E6) - Azide and BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,ELISA.

target :

SHIP2/INPPL1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3.00E+06

conjugate :

Unconjugated

host :

Mouse

immunogen :

PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLG
EAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDL
EEAGVQDPAHKRLLLDTLQLSK
INPPL1 (NP_001558, 1159 a.a. ~ 1258 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human,Monkey

specificity :

INPPL1 - inositol polyphosphate phosphatase-like 1

gene symbol :

INPPL1

accessionNumbers :

NP_001558

applications :

Western Blot,Immunocytochemistry/ Immunofluorescence,ELISA

USD :

529 USD

alt names :

EC 3.1.3, EC 3.1.3.n1, inositol polyphosphate phosphatase-like 1, Inositol polyphosphate phosphatase-like protein 1, INPPL-1, phosphatidylinositol-34,5-trisphosphate 5-phosphatase 2, Protein 51C, SH2 domain-containing inositol phosphatase 2, SH2 domain-containing inositol-5'-phosphatase 2, SHIP-2, SHIP251C protein

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage