product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) - Azide and BSA Free
catalog :
H00003340-M01
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1G10
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
product information
master code :
H00003340-M01
SKU :
H00003340-M01
product name :
N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) - Azide and BSA Free
unit size :
0.1 mg
description :
The N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) - Azide and BSA Free from Novus is a mouse monoclonal antibody to N-Deacetylase/N-Sulfotransferase 1/NDST1. This antibody reacts with human. The N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Sandwich ELISA.
target :
N-Deacetylase/N-Sulfotransferase 1/NDST1
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
1G10
conjugate :
Unconjugated
host :
Mouse
immunogen :
LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAA
TPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEI
APGKGDMPTLTDKGRGRFALI
NDST1 (NP_001534, 38 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
TPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEI
APGKGDMPTLTDKGRGRFALI
NDST1 (NP_001534, 38 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human
specificity :
NDST1 - N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1
gene symbol :
NDST1
accessionNumbers :
NP_001534
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Sandwich ELISA
USD :
499 USD
alt names :
[Heparan sulfate]-glucosamine N-sulfotransferase 1, bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1, EC 2.8.2.8, Glucosaminyl N-deacetylase/N-sulfotransferase 1, heparan sulfate-N-deacetylase/N-sulfotransferase, HSNST 1, HSST1, HSSTN-HSST 1, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1, NDST-1, N-heparan sulfate sulfotransferase 1, NST1
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
browse more products
- SARS Nucleocapsid Protein Antibody - BSA Free | NB100-56050-0.1mg
- ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody (LN-1) - Azide and BSA Free
- Cyclin D1 Antibody (CCND1/809) - Azide and BSA Free | NBP2-47921-0.1mg
- Chromogranin A Antibody (CGA/413 + CHGA/777 + CHGA/798) - Azide and BSA Free
- MUC1 Antibody (MUC1/845) - Azide and BSA Free | NBP2-47881-0.1mg
questions and comments
