HOXB7 Antibody (4C6) - Azide and BSA Free | Novus Biologicals H00003217-M03 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

HOXB7 Antibody (4C6) - Azide and BSA Free

catalog :

H00003217-M03

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4C6

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Wu X, Li J, Yan T, Ke X, Li X, Zhu Y, et al. HOXB7 acts as an oncogenic biomarker in head and neck squamous cell carcinoma. Cancer Cell Int. 2021;21:393 pubmed publisher
Shi Z, Zhang H, Jie S, Yang X, Huang Q, Mao Y, et al. Long non-coding RNA SNHG8 promotes prostate cancer progression through repressing miR-384 and up-regulating HOXB7. J Gene Med. 2021;23:e3309 pubmed publisher
Zhou T, Fu H, Dong B, Dai L, Yang Y, Yan W, et al. HOXB7 mediates cisplatin resistance in esophageal squamous cell carcinoma through involvement of DNA damage repair. Thorac Cancer. 2020;11:3071-3085 pubmed publisher
Zhao H, Li X, Guan W, Han X. Impact of co-blocking the costimulatory signals on immune-related genes after high-risk rabbit corneal allograft using 2nd-generation DNA sequencing technology. Genet Mol Biol. 2019;42:472-479 pubmed publisher
Dai L, Hu W, Yang Z, Chen D, He B, Chen Y, et al. Upregulated expression of HOXB7 in intrahepatic cholangiocarcinoma is associated with tumor cell metastasis and poor prognosis. Lab Invest. 2019;99:736-748 pubmed publisher
Li H, Shen L, Yan W, Dong B, Kang X, Dai L, et al. Deregulated HOXB7 Expression Predicts Poor Prognosis of Patients with Esophageal Squamous Cell Carcinoma and Regulates Cancer Cell Proliferation In Vitro and In Vivo. PLoS ONE. 2015;10:e0130551 pubmed publisher
Kraiklang R, Pairojkul C, Khuntikeo N, Imtawil K, Wongkham S, Wongkham C. A novel predictive equation for potential diagnosis of cholangiocarcinoma. PLoS ONE. 2014;9:e89337 pubmed publisher
Nguyen Kovochich A, Arensman M, Lay A, Rao N, Donahue T, Li X, et al. HOXB7 promotes invasion and predicts survival in pancreatic adenocarcinoma. Cancer. 2013;119:529-39 pubmed publisher

product information

master code :

H00003217-M03

SKU :

H00003217-M03

product name :

HOXB7 Antibody (4C6) - Azide and BSA Free

unit size :

0.1 mg

description :

The HOXB7 Antibody (4C6) - Azide and BSA Free from Novus is a mouse monoclonal antibody to HOXB7. This antibody reacts with human,rabbit. The HOXB7 Antibody (4C6) - Azide and BSA Free has been validated for the following applications: IF/IHC,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Functional.

target :

HOXB7

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

4C6

conjugate :

Unconjugated

host :

Mouse

immunogen :

MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFE
QNLSGVCPGDSAKAAGAKEQRDSDLAA
HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human,Rabbit

specificity :

HOXB7 - homeobox B7

gene symbol :

HOXB7

accessionNumbers :

NP_004493

applications :

IF/IHC,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Functional

USD :

499 USD

alt names :

HHO.C1, homeo box 2C, homeo box B7, homeo box c1 protein, homeobox B7, Homeobox protein HHO.C1, Homeobox protein Hox-2C, homeobox protein Hox-B7, HOX2, HOX2CHox-2.3

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage