HNF-3 beta/FoxA2 Antibody (6C12) - Azide and BSA Free | Novus Biologicals H00003170-M12 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

HNF-3 beta/FoxA2 Antibody (6C12) - Azide and BSA Free

catalog :

H00003170-M12

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6C12

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 16

Reference
Sabir M, Leoyklang P, Hackbarth M, Pak E, Dutra A, Tait R, et al. Generation and characterization of two iPSC lines derived from subjects with Free Sialic Acid Storage Disorder (FSASD). Stem Cell Res. 2024;81:103600 pubmed publisher
Huang Y, Xu Y, Zhu J, Wan J, Xiong Y, Jiang Z, et al. An artificial LAMA2-GelMA hydrogel microenvironment for the development of pancreatic endocrine progenitors. Biomaterials. 2022;291:121882 pubmed publisher
Kim J, Hong J, Kang K, Lee B, Park Y, Kim B. Generation of the human pluripotent stem cell lines KUMi005-A from a patients with multiple myeloma. Stem Cell Res. 2022;65:102939 pubmed publisher
Kim J, Kang K, Lee B, Park Y, Kim B. Generation of human induced iPSC KUMi003-A from acute promyelocytic leukemia (APL) M3. Stem Cell Res. 2022;63:102861 pubmed publisher
Kim J, Kang K, Lee B, Park Y, Kim B. Generation of induced pluripotent stem cell line KUMi002-A with normal karyotype from a patient with Philadelphia chromosome-positive chronic myeloid leukemia. Stem Cell Res. 2021;55:102465 pubmed publisher
Kim J, Kang K, Lee B, Park Y, Kim B. Generation of the induced pluripotent stem cell line KUMi001-A carrying the Philadelphia chromosome from a chronic myeloid leukemia patient. Stem Cell Res. 2021;55:102464 pubmed publisher
Yamasaki A, Warshaw J, Kyalwazi B, Matsui H, Jepsen K, Panopoulos A. An iPSC line derived from a human acute myeloid leukemia cell line (HL-60-iPSC) retains leukemic abnormalities and displays myeloid differentiation defects. Stem Cell Res. 2020;49:102096 pubmed publisher
Lee S, Kim J, Kang K, Lee B, Kim B. Generation of normal induced pluripotent stem cell line KUMCi002-A from bone marrow CD34+ cells of patient with multiple myeloma disease having 13q deletion and IGH translocation. Stem Cell Res. 2020;49:102030 pubmed publisher
Serra Vinardell J, Sandler M, Pak E, Zheng W, Dutra A, Introne W, et al. Generation and characterization of four Chediak-Higashi Syndrome (CHS) induced pluripotent stem cell (iPSC) lines. Stem Cell Res. 2020;47:101883 pubmed publisher
DeLaForest A, Quryshi A, Frolkis T, Franklin O, Battle M. GATA4 Is Required for Budding Morphogenesis of Posterior Foregut Endoderm in a Model of Human Stomach Development. Front Med (Lausanne). 2020;7:44 pubmed publisher
Schill D, Nord J, Cirillo L. FoxO1 and FoxA1/2 form a complex on DNA and cooperate to open chromatin at insulin regulated genes. Biochem Cell Biol. 2018;: pubmed publisher
Chua C, Epsi N, Leung E, Xuan S, Lei M, Li B, et al. Differential requirements of androgen receptor in luminal progenitors during prostate regeneration and tumor initiation. elife. 2018;7: pubmed publisher
Vanova T, Konecna Z, Zbonakova Z, La Venuta G, Zoufalova K, Jelínková S, et al. Tyrosine Kinase Expressed in Hepatocellular Carcinoma, TEC, Controls Pluripotency and Early Cell Fate Decisions of Human Pluripotent Stem Cells via Regulation of Fibroblast Growth Factor-2 Secretion. Stem Cells. 2017;35:2050-2059 pubmed publisher
Noto F, Determan M, Cai J, Cayo M, Mallanna S, Duncan S. Aneuploidy is permissive for hepatocyte-like cell differentiation from human induced pluripotent stem cells. BMC Res Notes. 2014;7:437 pubmed publisher
Sourisseau M, Goldman O, He W, Gori J, Kiem H, Gouon Evans V, et al. Hepatic cells derived from induced pluripotent stem cells of pigtail macaques support hepatitis C virus infection. Gastroenterology. 2013;145:966-969.e7 pubmed publisher
DeLaForest A, Nagaoka M, Si Tayeb K, Noto F, Konopka G, Battle M, et al. HNF4A is essential for specification of hepatic progenitors from human pluripotent stem cells. Development. 2011;138:4143-53 pubmed publisher

product information

master code :

H00003170-M12

SKU :

H00003170-M12

product name :

HNF-3 beta/FoxA2 Antibody (6C12) - Azide and BSA Free

unit size :

0.1 mg

description :

The HNF-3 beta/FoxA2 Antibody (6C12) - Azide and BSA Free from Novus is a mouse monoclonal antibody to HNF-3 beta/FoxA2. This antibody reacts with human. The HNF-3 beta/FoxA2 Antibody (6C12) - Azide and BSA Free has been validated for the following applications: Flow Cytometry,Western Blot,Immunofluorescence,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

HNF-3 beta/FoxA2

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

6C12

conjugate :

Unconjugated

host :

Mouse

immunogen :

HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMD
LKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAA
DTSYYQGVYSRPIMNSS
FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human

specificity :

forkhead box A2

gene symbol :

FOXA2

accessionNumbers :

NP_068556

applications :

Flow Cytometry,Western Blot,Immunofluorescence,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

499 USD

alt names :

forkhead box A2, Forkhead box protein A2, hepatic nuclear factor-3-beta, hepatocyte nuclear factor 3, beta, hepatocyte nuclear factor 3-beta, HNF-3B, HNF-3-beta, HNF3BTCF-3B, MGC19807, TCF3B, Transcription factor 3B

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage