HMGB1/HMG-1 Antibody (2F6) - Azide and BSA Free | Novus Biologicals H00003146-M08 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

HMGB1/HMG-1 Antibody (2F6) - Azide and BSA Free

catalog :

H00003146-M08

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2F6

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, neutralization, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 16

Reference
Bhuyan S, Pal B, Pathak L, Saikia P, Mitra S, Gayan S, et al. Targeting hypoxia-induced tumor stemness by activating pathogen-induced stem cell niche defense. Front Immunol. 2022;13:933329 pubmed publisher
Liu L, Liu S, Luo H, Chen C, Zhang X, He L, et al. GPR30-mediated HMGB1 upregulation in CAFs induces autophagy and tamoxifen resistance in ERα-positive breast cancer cells. Aging (Albany NY). 2021;13:16178-16197 pubmed publisher
Yang L, Ye F, Zeng L, Li Y, Chai W. Knockdown of HMGB1 Suppresses Hypoxia-Induced Mitochondrial Biogenesis in Pancreatic Cancer Cells. Onco Targets Ther. 2020;13:1187-1198 pubmed publisher
Ye F, Chai W, Xie M, Yang M, Yu Y, Cao L, et al. HMGB1 regulates erastin-induced ferroptosis via RAS-JNK/p38 signaling in HL-60/NRASQ61L cells. Am J Cancer Res. 2019;9:730-739 pubmed
Livezey M, Huang R, Hergenrother P, Shapiro D. Strong and sustained activation of the anticipatory unfolded protein response induces necrotic cell death. Cell Death Differ. 2018;25:1796-1807 pubmed publisher
Chen X, Ma J, Kwan T, Stribos E, Messchendorp A, Loh Y, et al. Blockade of HMGB1 Attenuates Diabetic Nephropathy in Mice. Sci Rep. 2018;8:8319 pubmed publisher
Xie Y, Zhu S, Zhong M, Yang M, Sun X, Liu J, et al. Inhibition of Aurora Kinase A Induces Necroptosis in Pancreatic Carcinoma. Gastroenterology. 2017;153:1429-1443.e5 pubmed publisher
Di Candia L, Gomez E, Venereau E, Chachi L, Kaur D, Bianchi M, et al. HMGB1 is upregulated in the airways in asthma and potentiates airway smooth muscle contraction via TLR4. J Allergy Clin Immunol. 2017;140:584-587.e8 pubmed publisher
Yu Y, Xie Y, Cao L, Yang L, Yang M, Lotze M, et al. The ferroptosis inducer erastin enhances sensitivity of acute myeloid leukemia cells to chemotherapeutic agents. Mol Cell Oncol. 2015;2:e1054549 pubmed publisher
Yang M, Liu L, Xie M, Sun X, Yu Y, Kang R, et al. Poly-ADP-ribosylation of HMGB1 regulates TNFSF10/TRAIL resistance through autophagy. Autophagy. 2015;11:214-24 pubmed publisher
Amornsupak K, Insawang T, Thuwajit P, O charoenrat P, Eccles S, Thuwajit C. Cancer-associated fibroblasts induce high mobility group box 1 and contribute to resistance to doxorubicin in breast cancer cells. BMC Cancer. 2014;14:955 pubmed publisher
Livesey K, Kang R, Vernon P, Buchser W, Loughran P, Watkins S, et al. p53/HMGB1 complexes regulate autophagy and apoptosis. Cancer Res. 2012;72:1996-2005 pubmed publisher
Tang D, Kang R, Livesey K, Zeh H, Lotze M. High mobility group box 1 (HMGB1) activates an autophagic response to oxidative stress. Antioxid Redox Signal. 2011;15:2185-95 pubmed publisher
Kang R, Tang D, Livesey K, Schapiro N, Lotze M, Zeh H. The Receptor for Advanced Glycation End-products (RAGE) protects pancreatic tumor cells against oxidative injury. Antioxid Redox Signal. 2011;15:2175-84 pubmed publisher
Gong W, Zheng Y, Chao F, Li Y, Xu Z, Huang G, et al. The anti-inflammatory activity of HMGB1 A box is enhanced when fused with C-terminal acidic tail. J Biomed Biotechnol. 2010;2010:915234 pubmed publisher
Zhou J, Huang J, Poon V, Chen D, Chan C, Ng F, et al. Functional dissection of an IFN-alpha/beta receptor 1 promoter variant that confers higher risk to chronic hepatitis B virus infection. J Hepatol. 2009;51:322-32 pubmed publisher

product information

master code :

H00003146-M08

SKU :

H00003146-M08

product name :

HMGB1/HMG-1 Antibody (2F6) - Azide and BSA Free

unit size :

0.1 mg

description :

The HMGB1/HMG-1 Antibody (2F6) - Azide and BSA Free from Novus is a mouse monoclonal antibody to HMGB1/HMG-1. This antibody reacts with e. coli,human. The HMGB1/HMG-1 Antibody (2F6) - Azide and BSA Free has been validated for the following applications: Western Blot,Knockdown Validated,Block/Neutralize,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

HMGB1/HMG-1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

2F6

conjugate :

Unconjugated

host :

Mouse

immunogen :

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFS
EFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTY
IPPKGETKKKFK
HMGB1 (NP_002119, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

E. coli,Human

specificity :

HMGB1 - high-mobility group box 1

gene symbol :

HMGB1

Antibody validation :

Knockout/Knockdown

accessionNumbers :

NP_002119

applications :

Western Blot,Knockdown Validated,Block/Neutralize,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

529 USD

alt names :

Amphoterin, high mobility group box 1, High mobility group protein 1, high mobility group protein B1, high-mobility group (nonhistone chromosomal) protein 1, high-mobility group box 1, HMG-1, HMG1DKFZp686A04236, HMG3, SBP-1, Sulfoglucuronyl carbohydrate binding protein

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage