Histone H3.3B Antibody (2D7-H1) - Azide and BSA Free | Novus Biologicals H00003021-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Histone H3.3B Antibody (2D7-H1) - Azide and BSA Free

catalog :

H00003021-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2D7-H1

reactivity :

human, mouse, bovine

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 14

Reference
Bush K, Cervantes V, Yee J, Klein R, Knoepfler P. A knockout-first model of H3f3a gene targeting leads to developmental lethality. Genesis. 2023;61:e23507 pubmed publisher
Reske J, Wilson M, Armistead B, Harkins S, Perez C, Hrit J, et al. ARID1A-dependent maintenance of H3.3 is required for repressive CHD4-ZMYND8 chromatin interactions at super-enhancers. BMC Biol. 2022;20:209 pubmed publisher
Wang X, Wang L, Dou J, Yu T, Cao P, Fan N, et al. Distinct role of histone chaperone Asf1a and Asf1b during fertilization and pre-implantation embryonic development in mice. Epigenetics Chromatin. 2021;14:55 pubmed publisher
Mei H, Kozuka C, Hayashi R, Kumon M, Koseki H, Inoue A. H2AK119ub1 guides maternal inheritance and zygotic deposition of H3K27me3 in mouse embryos. Nat Genet. 2021;53:539-550 pubmed publisher
Zhang K, Wang H, Rajput S, Folger J, Smith G. Characterization of H3.3 and HIRA expression and function in bovine early embryos. Mol Reprod Dev. 2017;: pubmed publisher
Pradhan S, Su T, Yen L, Jacquet K, Huang C, CÃ´tÃ© J, et al. EP400 Deposits H3.3 into Promoters and Enhancers during Gene Activation. Mol Cell. 2016;61:27-38 pubmed publisher
Jang C, Shibata Y, Starmer J, Yee D, Magnuson T. Histone H3.3 maintains genome integrity during mammalian development. Genes Dev. 2015;29:1377-92 pubmed publisher
Hammoud S, Low D, Yi C, Carrell D, Guccione E, Cairns B. Chromatin and transcription transitions of mammalian adult germline stem cells and spermatogenesis. Cell Stem Cell. 2014;15:239-53 pubmed publisher
Lin C, Conti M, Ramalho Santos M. Histone variant H3.3 maintains a decondensed chromatin state essential for mouse preimplantation development. Development. 2013;140:3624-34 pubmed publisher
Orsi G, Algazeery A, Meyer R, Capri M, Sapey Triomphe L, Horard B, et al. Drosophila Yemanuclein and HIRA cooperate for de novo assembly of H3.3-containing nucleosomes in the male pronucleus. PLoS Genet. 2013;9:e1003285 pubmed publisher
Jullien J, Astrand C, Szenker E, Garrett N, Almouzni G, Gurdon J. HIRA dependent H3.3 deposition is required for transcriptional reprogramming following nuclear transfer to Xenopus oocytes. Epigenetics Chromatin. 2012;5:17 pubmed publisher
Szenker E, Lacoste N, Almouzni G. A developmental requirement for HIRA-dependent H3.3 deposition revealed at gastrulation in Xenopus. Cell Rep. 2012;1:730-40 pubmed publisher
Sabirzhanov B, Keifer J. Cloning and characterization of glutamate receptor subunit 4 (GLUA4) and its alternatively spliced isoforms in turtle brain. J Mol Neurosci. 2011;44:159-72 pubmed publisher
Drané P, Ouararhni K, Depaux A, Shuaib M, Hamiche A. The death-associated protein DAXX is a novel histone chaperone involved in the replication-independent deposition of H3.3. Genes Dev. 2010;24:1253-65 pubmed publisher

product information

master code :

H00003021-M01

SKU :

H00003021-M01

product name :

Histone H3.3B Antibody (2D7-H1) - Azide and BSA Free

unit size :

0.1 mg

description :

The Histone H3.3B Antibody (2D7-H1) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Histone H3.3B. This antibody reacts with bovine,drosophila,human,mouse,xenopus,frog - xenopus (african clawed frog). The Histone H3.3B Antibody (2D7-H1) - Azide and BSA Free has been validated for the following applications: Knockout Validated,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

Histone H3.3B

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

2D7-H1

conjugate :

Unconjugated

host :

Mouse

immunogen :

MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKP
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQD
FKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKR
VTIMPKDIQLARRIRGERA
H3F3B (AAH17558, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Bovine,Drosophila,Human,Mouse,Xenopus,Frog - Xenopus (African Clawed Frog)

specificity :

H3F3B - H3 histone, family 3B (H3

gene symbol :

H3F3B

accessionNumbers :

AAH17558

applications :

Knockout Validated,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

H3 histone, family 3A, H3 histone, family 3B (H3.3B), H3.3BH3.3A, H3F3, H3F3A, histone H3.3

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage