Glycogenin 1 Antibody (3B5) - Azide and BSA Free | Novus Biologicals H00002992-M07 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Glycogenin 1 Antibody (3B5) - Azide and BSA Free

catalog :

H00002992-M07

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3B5

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 12

Reference
Endoh M, Baba M, Endoh T, Hirayama A, Nakamura Ishizu A, Umemoto T, et al. A FLCN-TFE3 Feedback Loop Prevents Excessive Glycogenesis and Phagocyte Activation by Regulating Lysosome Activity. Cell Rep. 2020;30:1823-1834.e5 pubmed publisher
Hedberg Oldfors C, De Ridder W, Kalev O, B xf6 ck K, Visuttijai K, Caravias G, et al. Functional characterization of GYG1 variants in two patients with myopathy and glycogenin-1 deficiency. Neuromuscul Disord. 2019;29:951-960 pubmed publisher
Visuttijai K, Hedberg Oldfors C, Thomsen C, Glamuzina E, Kornblum C, Tasca G, et al. Glycogenin is Dispensable for Glycogen Synthesis in Human Muscle, and Glycogenin Deficiency Causes Polyglucosan Storage. J Clin Endocrinol Metab. 2020;105:557-66 pubmed publisher
. Clinical heterogeneity and phenotype/genotype findings in 5 families with GYG1 deficiency. Neurol Genet. 2017;3:e208 pubmed publisher
Testoni G, Duran J, GarcÃa Rocha M, Vilaplana F, Serrano A, SebastiÃ¡n D, et al. Lack of Glycogenin Causes Glycogen Accumulation and Muscle Function Impairment. Cell Metab. 2017;26:256-266.e4 pubmed publisher
Hedberg Oldfors C, Glamuzina E, Ruygrok P, Anderson L, Elliott P, Watkinson O, et al. Cardiomyopathy as presenting sign of glycogenin-1 deficiency-report of three cases and review of the literature. J Inherit Metab Dis. 2017;40:139-149 pubmed publisher
Tasca G, Fattori F, Monforte M, Hedberg Oldfors C, Sabatelli M, Udd B, et al. Start codon mutation of GYG1 causing late-onset polyglucosan body myopathy with nemaline rods. J Neurol. 2016;263:2133-5 pubmed publisher
Malfatti E, Nilsson J, Hedberg Oldfors C, Hernandez Lain A, Michel F, Domínguez González C, et al. A new muscle glycogen storage disease associated with glycogenin-1 deficiency. Ann Neurol. 2014;76:891-8 pubmed publisher
Nilsson J, Halim A, Larsson E, Moslemi A, Oldfors A, Larson G, et al. LC-MS/MS characterization of combined glycogenin-1 and glycogenin-2 enzymatic activities reveals their self-glucosylation preferences. Biochim Biophys Acta. 2014;1844:398-405 pubmed publisher
Taylor K, Meyers E, Phipps M, Kishnani P, Cheng S, Scheule R, et al. Dysregulation of multiple facets of glycogen metabolism in a murine model of Pompe disease. PLoS ONE. 2013;8:e56181 pubmed publisher
Nilsson J, Halim A, Moslemi A, Pedersen A, Nilsson J, Larson G, et al. Molecular pathogenesis of a new glycogenosis caused by a glycogenin-1 mutation. Biochim Biophys Acta. 2012;1822:493-9 pubmed publisher
Shinozaki S, Choi C, Shimizu N, Yamada M, Kim M, Zhang T, et al. Liver-specific inducible nitric-oxide synthase expression is sufficient to cause hepatic insulin resistance and mild hyperglycemia in mice. J Biol Chem. 2011;286:34959-75 pubmed publisher

product information

master code :

H00002992-M07

SKU :

H00002992-M07

product name :

Glycogenin 1 Antibody (3B5) - Azide and BSA Free

unit size :

0.1 mg

description :

The Glycogenin 1 Antibody (3B5) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Glycogenin 1. This antibody reacts with human,mouse,rat. The Glycogenin 1 Antibody (3B5) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen.

target :

Glycogenin 1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3B5

conjugate :

Unconjugated

host :

Mouse

immunogen :

MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLA
TPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT
GYG1 (NP_004121, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Mouse,Rat

specificity :

GYG1 - glycogenin 1

gene symbol :

GYG1

accessionNumbers :

NP_004121

applications :

ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen

USD :

529 USD

alt names :

EC 2.4.1.186, glycogenin, glycogenin 1, glycogenin-1, GN1, GN-1, GSD15, GYG

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage