Glutaminase Antibody (5C4) - Azide and BSA Free | Novus Biologicals H00002744-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Glutaminase Antibody (5C4) - Azide and BSA Free

catalog :

H00002744-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

5C4

reactivity :

human, mouse

application :

western blot, ELISA, immunocytochemistry

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Pitirollo O, Di Benedetto R, Henriques P, Gasperini G, Mancini F, Carducci M, et al. Elucidating the role of N-acetylglucosamine in Group A Carbohydrate for the development of an effective glycoconjugate vaccine against Group A Streptococcus. Carbohydr Polym. 2023;311:120736 pubmed publisher
Lin J, Lian N, Gao Y, Zheng Q, Yang Y, Ma Y, et al. m6A methylation mediates LHPP acetylation as a tumour aerobic glycolysis suppressor to improve the prognosis of gastric cancer. Cell Death Dis. 2022;13:463 pubmed publisher
Polletta L, Vernucci E, Carnevale I, Arcangeli T, Rotili D, Palmerio S, et al. SIRT5 regulation of ammonia-induced autophagy and mitophagy. Autophagy. 2015;11:253-70 pubmed publisher
Hida H, Mouri A, Ando Y, Mori K, Mamiya T, Iwamoto K, et al. Combination of neonatal PolyI:C and adolescent phencyclidine treatments is required to induce behavioral abnormalities with overexpression of GLAST in adult mice. Behav Brain Res. 2014;258:34-42 pubmed publisher
Reynolds M, Lane A, Robertson B, Kemp S, Liu Y, Hill B, et al. Control of glutamine metabolism by the tumor suppressor Rb. Oncogene. 2014;33:556-66 pubmed publisher
Cassago A, Ferreira A, Ferreira I, Fornezari C, Gomes E, Greene K, et al. Mitochondrial localization and structure-based phosphate activation mechanism of Glutaminase C with implications for cancer metabolism. Proc Natl Acad Sci U S A. 2012;109:1092-7 pubmed publisher
Cole J, Mitala C, Kundu S, Verma A, Elkind J, Nissim I, et al. Dietary branched chain amino acids ameliorate injury-induced cognitive impairment. Proc Natl Acad Sci U S A. 2010;107:366-71 pubmed publisher
Unterluggauer H, Mazurek S, Lener B, Hutter E, Eigenbrodt E, Zwerschke W, et al. Premature senescence of human endothelial cells induced by inhibition of glutaminase. Biogerontology. 2008;9:247-59 pubmed publisher

product information

master code :

H00002744-M01

SKU :

H00002744-M01

product name :

Glutaminase Antibody (5C4) - Azide and BSA Free

unit size :

0.1 mg

description :

The Glutaminase Antibody (5C4) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Glutaminase. This antibody reacts with human,mouse. The Glutaminase Antibody (5C4) - Azide and BSA Free has been validated for the following applications: ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence.

target :

Glutaminase

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

5C4

conjugate :

Unconjugated

host :

Mouse

immunogen :

EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDR
WNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKE
NQTVHKNLDGLL
GLS (NP_055720, 580 a.a. ~ 669 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Mouse

specificity :

GLS - glutaminase

gene symbol :

GLS

accessionNumbers :

NP_055720

applications :

ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

AAD20, EC 3.5.1.2, GLS1DKFZp686O15119, glutaminase, glutaminase C, glutaminase kidney isoform, mitochondrial, glutaminase, phosphate-activated, K-glutaminase, KIAA0838FLJ10358, L-glutamine amidohydrolase

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage