GCLC Antibody (3H1) - Azide and BSA Free | Novus Biologicals H00002729-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

GCLC Antibody (3H1) - Azide and BSA Free

catalog :

H00002729-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3H1

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunocytochemistry

more info or order :

Novus Biologicals product webpage

citations: 16

Reference
Stewart A, Glaser E, Mott C, Bailey W, Sullivan P, Patel S, et al. Advanced Age and Neurotrauma Diminish Glutathione and Impair Antioxidant Defense after Spinal Cord Injury. J Neurotrauma. 2022;39:1075-1089 pubmed publisher
Stewart A, Glaser E, Bailey W, Gensel J. Immunoglobulin G Is Increased in the Injured Spinal Cord in a Sex- and Age-Dependent Manner. J Neurotrauma. 2022;39:1090-1098 pubmed publisher
Kim D, Jang J, Kwon O, Cha H, Youn H, Chun K, et al. Nuclear Factor Erythroid-Derived 2-Like 2-Induced Reductive Stress Favors Self-Renewal of Breast Cancer Stem-Like Cells via the FoxO3a-Bmi-1 Axis. Antioxid Redox Signal. 2020;32:1313-1329 pubmed publisher
Takahashi S, Hisatsune A, Kurauchi Y, Seki T, Katsuki H. Polysulfide protects midbrain dopaminergic neurons from MPP+-induced degeneration via enhancement of glutathione biosynthesis. J Pharmacol Sci. 2018;137:47-54 pubmed publisher
Beatty A, Fink L, Singh T, Strigun A, Peter E, Ferrer C, et al. Metabolite Profiling Reveals the Glutathione Biosynthetic Pathway as a Therapeutic Target in Triple-Negative Breast Cancer. Mol Cancer Ther. 2018;17:264-275 pubmed publisher
Takahashi S, Hisatsune A, Kurauchi Y, Seki T, Katsuki H. Insulin-like growth factor 1 specifically up-regulates expression of modifier subunit of glutamate-cysteine ligase and enhances glutathione synthesis in SH-SY5Y cells. Eur J Pharmacol. 2016;771:99-106 pubmed publisher
SÃ¡nchez MartÃn F, Fan Y, Carreira V, Ovesen J, Vonhandorf A, Xia Y, et al. Long-term Coexposure to Hexavalent Chromium and B[a]P Causes Tissue-Specific Differential Biological Effects in Liver and Gastrointestinal Tract of Mice. Toxicol Sci. 2015;146:52-64 pubmed publisher
VenÃ¨ R, Cardinali B, Arena G, Ferrari N, Benelli R, Minghelli S, et al. Glycogen synthase kinase 3 regulates cell death and survival signaling in tumor cells under redox stress. Neoplasia. 2014;16:710-22 pubmed publisher
Sugiyama K, Ebinuma H, Nakamoto N, Sakasegawa N, Murakami Y, Chu P, et al. Prominent steatosis with hypermetabolism of the cell line permissive for years of infection with hepatitis C virus. PLoS ONE. 2014;9:e94460 pubmed publisher
Fan X, Liu X, Hao S, Wang B, Robinson M, Monnier V. The LEGSKO mouse: a mouse model of age-related nuclear cataract based on genetic suppression of lens glutathione synthesis. PLoS ONE. 2012;7:e50832 pubmed publisher
Li M, Gunter M, Fukagawa N. Differential activation of the inflammasome in THP-1 cells exposed to chrysotile asbestos and Libby "six-mix" amphiboles and subsequent activation of BEAS-2B cells. Cytokine. 2012;60:718-30 pubmed publisher
Kang H, Hong Y, Kim H, Wang A, Bae I. Bioactive food components prevent carcinogenic stress via Nrf2 activation in BRCA1 deficient breast epithelial cells. Toxicol Lett. 2012;209:154-60 pubmed publisher
Abel E, Bubel J, Simper M, Powell L, McClellan S, Andreeff M, et al. Protection against 2-chloroethyl ethyl sulfide (CEES)-induced cytotoxicity in human keratinocytes by an inducer of the glutathione detoxification pathway. Toxicol Appl Pharmacol. 2011;255:176-83 pubmed publisher
Hardwick R, Fisher C, Canet M, Lake A, Cherrington N. Diversity in antioxidant response enzymes in progressive stages of human nonalcoholic fatty liver disease. Drug Metab Dispos. 2010;38:2293-301 pubmed publisher
Yang H, Ko K, Xia M, Li T, Oh P, Li J, et al. Induction of avian musculoaponeurotic fibrosarcoma proteins by toxic bile acid inhibits expression of glutathione synthetic enzymes and contributes to cholestatic liver injury in mice. Hepatology. 2010;51:1291-301 pubmed publisher
Yang H, Ramani K, Xia M, Ko K, Li T, Oh P, et al. Dysregulation of glutathione synthesis during cholestasis in mice: molecular mechanisms and therapeutic implications. Hepatology. 2009;49:1982-91 pubmed publisher

product information

master code :

H00002729-M01

SKU :

H00002729-M01

product name :

GCLC Antibody (3H1) - Azide and BSA Free

unit size :

0.1 mg

description :

The GCLC Antibody (3H1) - Azide and BSA Free from Novus is a mouse monoclonal antibody to GCLC. This antibody reacts with human,mouse,rat. The GCLC Antibody (3H1) - Azide and BSA Free has been validated for the following applications: Western Blot,ELISA,Immunocytochemistry/ Immunofluorescence.

target :

GCLC

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3H1

conjugate :

Unconjugated

host :

Mouse

immunogen :

EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRA
SGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKC
NQIANELCECPELLGSAFRKVKYSGSKTDSSN
GCLC (NP_001489, 528 a.a. ~ 637 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human,Mouse,Rat

specificity :

GCLC - glutamate-cysteine ligase, catalytic subunit

gene symbol :

GCLC

accessionNumbers :

NP_001489

applications :

Western Blot,ELISA,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

EC 6.3.2.2, gamma-ECS, Gamma-glutamylcysteine synthetase, GCS, GCS heavy chain, GLCL, GLCLCGCL, glutamate--cysteine ligase catalytic subunit, glutamate-cysteine ligase, catalytic subunit

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage