GGT1 Antibody (1F9) - Azide and BSA Free | Novus Biologicals H00002678-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

GGT1 Antibody (1F9) - Azide and BSA Free

catalog :

H00002678-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1F9

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 10

Reference
Yoshida D, Kamiya M, Kawashima S, Yoshioka T, Hino H, Abe A, et al. Rapid imaging of thymoma and thymic carcinoma with a fluorogenic probe targeting γ-glutamyltranspeptidase. Sci Rep. 2023;13:3757 pubmed publisher
Kawashima S, Yoshioka T, Hino H, Kitano K, Nagayama K, Sato M, et al. ɤ-glutamyl hydroxymethyl rhodamine green fluorescence as a prognostic indicator for lung cancer. Gen Thorac Cardiovasc Surg. 2020;68:1418-1424 pubmed publisher
Akashi T, Isomoto H, Matsushima K, Kamiya M, Kanda T, Nakano M, et al. A novel method for rapid detection of a Helicobacter pylori infection using a γ-glutamyltranspeptidase-activatable fluorescent probe. Sci Rep. 2019;9:9467 pubmed publisher
Kubo H, Hanaoka K, Kuriki Y, Komatsu T, Ueno T, Kojima R, et al. Rapid detection of metastatic lymph nodes of colorectal cancer with a gamma-glutamyl transpeptidase-activatable fluorescence probe. Sci Rep. 2018;8:17781 pubmed publisher
Grammatikopoulos T, Deheragoda M, Strautnieks S, Neves Souza L, Hinds R, Thompson R, et al. Reduced Hepatocellular Expression of Canalicular Transport Proteins in Infants with Neonatal Cholestasis and Congenital Hypopituitarism. J Pediatr. 2018;200:181-187 pubmed publisher
Kawakami K, Fujita Y, Matsuda Y, Arai T, Horie K, Kameyama K, et al. Gamma-glutamyltransferase activity in exosomes as a potential marker for prostate cancer. BMC Cancer. 2017;17:316 pubmed publisher
Blackmore L, Knisely A, Hartley J, McKay K, Gissen P, Marcus R, et al. Polymorphisms in ABCB11 and ATP8B1 Associated with Development of Severe Intrahepatic Cholestasis in Hodgkin's Lymphoma. J Clin Exp Hepatol. 2013;3:159-61 pubmed publisher
Grau L, Luque Garcia J, Gonzalez Peramato P, Theodorescu D, Palou J, Fernández Gómez J, et al. A quantitative proteomic analysis uncovers the relevance of CUL3 in bladder cancer aggressiveness. PLoS ONE. 2013;8:e53328 pubmed publisher
West M, Wickham S, Quinalty L, Pavlovicz R, Li C, Hanigan M. Autocatalytic cleavage of human gamma-glutamyl transpeptidase is highly dependent on N-glycosylation at asparagine 95. J Biol Chem. 2011;286:28876-88 pubmed publisher
West M, Segu Z, Feasley C, Kang P, Klouckova I, Li C, et al. Analysis of site-specific glycosylation of renal and hepatic ?-glutamyl transpeptidase from normal human tissue. J Biol Chem. 2010;285:29511-24 pubmed publisher

product information

master code :

H00002678-M01

SKU :

H00002678-M01

product name :

GGT1 Antibody (1F9) - Azide and BSA Free

unit size :

0.1 mg

description :

The GGT1 Antibody (1F9) - Azide and BSA Free from Novus is a mouse monoclonal antibody to GGT1. This antibody reacts with human,mouse,yeast. The GGT1 Antibody (1F9) - Azide and BSA Free has been validated for the following applications: IF/IHC,ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence.

target :

GGT1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

1F9

conjugate :

Unconjugated

host :

Mouse

immunogen :

TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNN
EMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIM
VGQDGQVRMVVG
GGT1 (NP_005256, 381 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Mouse,Yeast

specificity :

GGT1 - gamma-glutamyltransferase 1

gene symbol :

GGT1

accessionNumbers :

NP_005256

applications :

IF/IHC,ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

CD224, CD224 antigen, D22S672, D22S732, EC 2.3.2.2, gamma-glutamyl transpeptidase, gamma-glutamyltransferase 1MGC96904, gamma-glutamyltranspeptidase 1, GGT 1, GGTMGC96963, glutamyl transpeptidase, GTG, MGC96892

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage