Glucosylceramidase/GBA Antibody (2E2) - Azide and BSA Free | Novus Biologicals H00002629-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Glucosylceramidase/GBA Antibody (2E2) - Azide and BSA Free

catalog :

H00002629-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2.00E+02

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 10

Reference
Dobert J, Bub S, M xe4 chtel R, Januliene D, Steger L, Regensburger M, et al. Activation and Purification of ß-Glucocerebrosidase by Exploiting its Transporter LIMP-2 - Implications for Novel Treatment Strategies in Gaucher's and Parkinson's Disease. Adv Sci (Weinh). 2024;11:e2401641 pubmed publisher
Jung J, Choi H, Huy N, Park H, Kim H, Yang M, et al. Production of recombinant human acid β-glucosidase with high mannose-type N-glycans in rice gnt1 mutant for potential treatment of Gaucher disease. Protein Expr Purif. 2019;158:81-88 pubmed publisher
Atashrazm F, Hammond D, Perera G, Dobson Stone C, Mueller N, Pickford R, et al. Reduced glucocerebrosidase activity in monocytes from patients with Parkinson's disease. Sci Rep. 2018;8:15446 pubmed publisher
Bendikov Bar I, Rapaport D, Larisch S, Horowitz M. Parkin-mediated ubiquitination of mutant glucocerebrosidase leads to competition with its substrates PARIS and ARTS. Orphanet J Rare Dis. 2014;9:86 pubmed publisher
Murphy K, Gysbers A, Abbott S, Tayebi N, Kim W, Sidransky E, et al. Reduced glucocerebrosidase is associated with increased ?-synuclein in sporadic Parkinson's disease. Brain. 2014;137:834-48 pubmed publisher
Bendikov Bar I, Horowitz M. Gaucher disease paradigm: from ERAD to comorbidity. Hum Mutat. 2012;33:1398-407 pubmed publisher
Babajani G, Tropak M, Mahuran D, Kermode A. Pharmacological chaperones facilitate the post-ER transport of recombinant N370S mutant ?-glucocerebrosidase in plant cells: evidence that N370S is a folding mutant. Mol Genet Metab. 2012;106:323-9 pubmed publisher
Bendikov Bar I, Ron I, Filocamo M, Horowitz M. Characterization of the ERAD process of the L444P mutant glucocerebrosidase variant. Blood Cells Mol Dis. 2011;46:4-10 pubmed publisher
Campeau P, Rafei M, Boivin M, Sun Y, Grabowski G, Galipeau J. Characterization of Gaucher disease bone marrow mesenchymal stromal cells reveals an altered inflammatory secretome. Blood. 2009;114:3181-90 pubmed publisher
Mu T, Fowler D, Kelly J. Partial restoration of mutant enzyme homeostasis in three distinct lysosomal storage disease cell lines by altering calcium homeostasis. PLoS Biol. 2008;6:e26 pubmed publisher

product information

master code :

H00002629-M01

SKU :

H00002629-M01

product name :

Glucosylceramidase/GBA Antibody (2E2) - Azide and BSA Free

unit size :

0.1 mg

description :

The Glucosylceramidase/GBA Antibody (2E2) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Glucosylceramidase/GBA. This antibody reacts with human,plant. The Glucosylceramidase/GBA Antibody (2E2) - Azide and BSA Free has been validated for the following applications: Western Blot,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

Glucosylceramidase/GBA

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

2.00E+02

conjugate :

Unconjugated

host :

Mouse

immunogen :

SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLH
NFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTW
LKTNGAVNGKGS
GBA (NP_000148, 146 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Plant

specificity :

GBA - glucosidase, beta; acid (includes glucosylceramidase)

gene symbol :

GBA1

accessionNumbers :

NP_000148

applications :

Western Blot,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

Acid beta-glucosidase, alglucerase, Beta-glucocerebrosidase, D-glucosyl-N-acylsphingosine glucohydrolase, EC 3.2.1.45, GBA1, GC, GCB, GLUC, glucosidase, beta, acid, glucosidase, beta; acid (includes glucosylceramidase), glucosylceramidase, imiglucerase, lysosomal glucocerebrosidase

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage