product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
FGFR2 Antibody (1G3) - Azide and BSA Free
catalog :
H00002263-M01
quantity :
0.1 mg
price :
539 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1G3
reactivity :
human, bovine
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
Novus Biologicals product webpage
citations: 13
Reference
Mieczkowski K, Kitowska K, Braun M, Galikowska Bogut B, Gorska Arcisz M, Piasecka D, et al. FGF7/FGFR2-JunB signalling counteracts the effect of progesterone in luminal breast cancer. Mol Oncol. 2022;16:2823-2842 pubmed publisher
Braun M, Piasecka D, Bobrowski M, Kordek R, Sadej R, Romanska H. A 'Real-Life' Experience on Automated Digital Image Analysis of FGFR2 Immunohistochemistry in Breast Cancer. Diagnostics (Basel). 2020;10: pubmed publisher
Turczyk L, Kitowska K, Mieszkowska M, Mieczkowski K, Czaplinska D, Piasecka D, et al. FGFR2-Driven Signaling Counteracts Tamoxifen Effect on ER?-Positive Breast Cancer Cells. Neoplasia. 2017;19:791-804 pubmed publisher
Czaplinska D, Mieczkowski K, Supernat A, Skladanowski A, Kordek R, Biernat W, et al. Interactions between FGFR2 and RSK2-implications for breast cancer prognosis. Tumour Biol. 2016;37:13721-13731 pubmed
Akizawa H, Nagatomo H, Odagiri H, Kohri N, Yamauchi N, Yanagawa Y, et al. Conserved roles of fibroblast growth factor receptor 2 signaling in the regulation of inner cell mass development in bovine blastocysts. Mol Reprod Dev. 2016;83:516-25 pubmed publisher
Yoon G, Lee H, Kim J, Hur K, Seo A. Clinical significance of fibroblast growth factor receptor 2 expression in patients with residual rectal cancer after preoperative chemoradiotherapy: relationship with KRAS or BRAF mutations and MSI status. Tumour Biol. 2016;37:10209-18 pubmed publisher
Lee H, Kang H, Kim K, Yu E, Kim K, Kim S, et al. Fibroblast growth factor receptor isotype expression and its association with overall survival in patients with hepatocellular carcinoma. Clin Mol Hepatol. 2015;21:60-70 pubmed publisher
Grygielewicz P, Dymek B, Bujak A, Gunerka P, Stanczak A, Lamparska Przybysz M, et al. Epithelial-mesenchymal transition confers resistance to selective FGFR inhibitors in SNU-16 gastric cancer cells. Gastric Cancer. 2016;19:53-62 pubmed publisher
Cazet A, Charest J, Bennett D, Sambrooks C, Contessa J. Mannose phosphate isomerase regulates fibroblast growth factor receptor family signaling and glioma radiosensitivity. PLoS ONE. 2014;9:e110345 pubmed publisher
Lee H, Seo A, Park S, Kim J, Park J, Yu J, et al. Low prognostic implication of fibroblast growth factor family activation in triple-negative breast cancer subsets. Ann Surg Oncol. 2014;21:1561-8 pubmed publisher
Katano H, Yamada K. Upregulation of ANGPTL4 messenger RNA and protein in severely calcified carotid plaques. J Stroke Cerebrovasc Dis. 2014;23:933-47 pubmed publisher
Vermeulen J, Kornegoor R, van der Wall E, van der Groep P, van Diest P. Differential expression of growth factor receptors and membrane-bound tumor markers for imaging in male and female breast cancer. PLoS ONE. 2013;8:e53353 pubmed publisher
Ozawa M, Yang Q, Ealy A. The expression of fibroblast growth factor receptors during early bovine conceptus development and pharmacological analysis of their actions on trophoblast growth in vitro. Reproduction. 2013;145:191-201 pubmed publisher
product information
master code :
H00002263-M01
SKU :
H00002263-M01
product name :
FGFR2 Antibody (1G3) - Azide and BSA Free
unit size :
0.1 mg
description :
The FGFR2 Antibody (1G3) - Azide and BSA Free from Novus is a mouse monoclonal antibody to FGFR2. This antibody reacts with bovine,human. The FGFR2 Antibody (1G3) - Azide and BSA Free has been validated for the following applications: IF/IHC,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence.
target :
FGFR2
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
1G3
conjugate :
Unconjugated
host :
Mouse
immunogen :
GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDL
DRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDS
VFSPDPMPYEPCLPQYPHINGSVKT
FGFR2 (AAH39243, 621 a.a. ~ 723 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2b Kappa
purity :
IgG purified
species :
Bovine,Human
specificity :
FGFR2 - fibroblast growth factor receptor 2 (bacteria-expressed kinase, keratinocyte growth factor receptor, craniofacial dysostosis 1, Crouzon syndrome, Pfeiffer syndrome, Jackson-Weiss syndrome)
gene symbol :
FGFR2
accessionNumbers :
AAH39243
applications :
IF/IHC,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence
USD :
539 USD
alt names :
BBDS, BEK, BFR-1, CD332, CD332 antigen, CEK3, CFD1, craniofacial dysostosis 1, EC 2.7.10, EC 2.7.10.1, ECT1, fibroblast growth factor receptor 2, FLJ98662, Jackson-Weiss syndrome, JWS, Keratinocyte growth factor receptorreceptor like 14, KGFR, K-sam, KSAM, soluble FGFR4 variant 4, TK14, TK25
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
Novus Biologicals product webpage
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.