product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
FGF-12 Antibody (1D9) - Azide and BSA Free
catalog :
H00002257-M10
quantity :
0.1 mg
price :
529 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1D9
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 2
| Reference |
|---|
product information
master code :
H00002257-M10
SKU :
H00002257-M10
product name :
FGF-12 Antibody (1D9) - Azide and BSA Free
unit size :
0.1 mg
description :
The FGF-12 Antibody (1D9) - Azide and BSA Free from Novus is a mouse monoclonal antibody to FGF-12. This antibody reacts with human. The FGF-12 Antibody (1D9) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
FGF-12
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
1D9
conjugate :
Unconjugated
host :
Mouse
immunogen :
MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENS
DYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDV
FTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNK
EGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGE
KQGRSRKSSGTPTMNGGKVVNQDST
FGF12 (AAH22524, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
DYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDV
FTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNK
EGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGE
KQGRSRKSSGTPTMNGGKVVNQDST
FGF12 (AAH22524, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG1 Kappa
purity :
IgG purified
species :
Human
specificity :
FGF12 (1D9)
gene symbol :
FGF12
accessionNumbers :
AAH22524
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
529 USD
alt names :
FGF-12, FGF12B, FHF-1, FHF1Fibroblast growth factor homologous factor 1, fibroblast growth factor 12, fibroblast growth factor 12B, fibroblast growth factor FGF-12b, Myocyte-activating factor
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
browse more products
- HSP10/EPF Antibody (4C11-B11) - Azide and BSA Free | H00003336-M01
- Ghrelin/Obestatin Antibody (2F4) - Azide and BSA Free | H00051738-M01
- NOP14 Antibody - Azide and BSA Free | H00008602-B01P
- CXCL7/NAP-2 Antibody (3B9) - Azide and BSA Free | H00005473-M01
- HIPK1 Antibody (4C2) - Azide and BSA Free | H00204851-M01
questions and comments
