EphB3 Antibody (1B3) - Azide and BSA Free | Novus Biologicals H00002049-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

EphB3 Antibody (1B3) - Azide and BSA Free

catalog :

H00002049-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1B3

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunoprecipitation, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Tsenkina Y, Tapanes S, D xed az M, Titus D, Gajavelli S, Bullock R, et al. EphB3 interacts with initiator caspases and FHL-2 to activate dependence receptor cell death in oligodendrocytes after brain injury. Brain Commun. 2020;2:fcaa175 pubmed publisher
Assis Nascimento P, Tsenkina Y, Liebl D. EphB3 signaling induces cortical endothelial cell death and disrupts the blood-brain barrier after traumatic brain injury. Cell Death Dis. 2018;9:7 pubmed publisher
Schauer M, Stoecklein N, Theisen J, Kröpil F, Baldus S, Hoelscher A, et al. The simultaneous expression of both ephrin B3 receptor and E-cadherin in Barrett`s adenocarcinoma is associated with favorable clinical staging. Eur J Med Res. 2012;17:10 pubmed publisher
Ogawa K, Takemoto N, Ishii M, Pasquale E, Nakajima T. Complementary expression and repulsive signaling suggest that EphB receptors and ephrin-B ligands control cell positioning in the gastric epithelium. Histochem Cell Biol. 2011;136:617-36 pubmed publisher
Ishii M, Nakajima T, Ogawa K. Complementary expression of EphB receptors and ephrin-B ligand in the pyloric and duodenal epithelium of adult mice. Histochem Cell Biol. 2011;136:345-56 pubmed publisher
Rönsch K, Jäger M, Schöpflin A, Danciu M, Lassmann S, Hecht A. Class I and III HDACs and loss of active chromatin features contribute to epigenetic silencing of CDX1 and EPHB tumor suppressor genes in colorectal cancer. Epigenetics. 2011;6:610-22 pubmed
Schauer M, Janssen K, Rimkus C, Raggi M, Feith M, Friess H, et al. Microarray-based response prediction in esophageal adenocarcinoma. Clin Cancer Res. 2010;16:330-7 pubmed publisher

product information

master code :

H00002049-M01

SKU :

H00002049-M01

product name :

EphB3 Antibody (1B3) - Azide and BSA Free

unit size :

0.1 mg

description :

The EphB3 Antibody (1B3) - Azide and BSA Free from Novus is a mouse monoclonal antibody to EphB3. This antibody reacts with human,mouse. The EphB3 Antibody (1B3) - Azide and BSA Free has been validated for the following applications: Western Blot,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen.

target :

EphB3

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

1B3

conjugate :

Unconjugated

host :

Mouse

immunogen :

AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAI
KMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQ
KKILSSIQDMRLQMNQTLPVQ
EPHB3 (NP_004434, 899 a.a. ~ 997 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Mouse

specificity :

EPHB3 - EPH receptor B3

gene symbol :

EPHB3

accessionNumbers :

NP_004434

applications :

Western Blot,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen

USD :

529 USD

alt names :

EC 2.7.10, EC 2.7.10.1, EK2, EPH receptor B3, EphB3, EPH-like kinase 2, EPH-like tyrosine kinase-2, ephrin type-B receptor 3, ETK2Hek2, HEK2, human embryo kinase 2, Tyro6, Tyrosine-protein kinase TYRO6

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage