ENO3 Antibody (5D1) - Azide and BSA Free | Novus Biologicals H00002027-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

ENO3 Antibody (5D1) - Azide and BSA Free

catalog :

H00002027-M01

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

5D1

reactivity :

human, rat, bovine

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section, dot blot

more info or order :

Novus Biologicals product webpage

citations: 14

Reference
Huppertz I, Perez Perri J, Mantas P, Sekaran T, Schwarzl T, Russo F, et al. Riboregulation of Enolase 1 activity controls glycolysis and embryonic stem cell differentiation. Mol Cell. 2022;82:2666-2680.e11 pubmed publisher
Picard B, Gagaoua M, Al Jammas M, Bonnet M. Beef tenderness and intramuscular fat proteomic biomarkers: Effect of gender and rearing practices. J Proteomics. 2019;200:1-10 pubmed publisher
Gagaoua M, Bonnet M, de Koning L, Picard B. Reverse Phase Protein array for the quantification and validation of protein biomarkers of beef qualities: The case of meat color from Charolais breed. Meat Sci. 2018;145:308-319 pubmed publisher
Picard B, Gagaoua M, Al Jammas M, de Koning L, Valais A, Bonnet M. Beef tenderness and intramuscular fat proteomic biomarkers: muscle type effect. Peerj. 2018;6:e4891 pubmed publisher
Gagaoua M, Bonnet M, Ellies Oury M, de Koning L, Picard B. Reverse phase protein arrays for the identification/validation of biomarkers of beef texture and their use for early classification of carcasses. Food Chem. 2018;250:245-252 pubmed publisher
Yu Q, Wu W, Tian X, Hou M, Dai R, Li X. Unraveling proteome changes of Holstein beef M. semitendinosus and its relationship to meat discoloration during post-mortem storage analyzed by label-free mass spectrometry. J Proteomics. 2017;154:85-93 pubmed publisher
Brocca L, Longa E, Cannavino J, Seynnes O, De Vito G, McPhee J, et al. Human skeletal muscle fibre contractile properties and proteomic profile: adaptations to 3 weeks of unilateral lower limb suspension and active recovery. J Physiol. 2015;593:5361-85 pubmed publisher
Gagaoua M, Terlouw E, Boudjellal A, Picard B. Coherent correlation networks among protein biomarkers of beef tenderness: What they reveal. J Proteomics. 2015;128:365-74 pubmed publisher
Picard B, Gagaoua M, Micol D, Cassar Malek I, Hocquette J, Terlouw C. Inverse relationships between biomarkers and beef tenderness according to contractile and metabolic properties of the muscle. J Agric Food Chem. 2014;62:9808-18 pubmed publisher
Brocca L, Cannavino J, Coletto L, Biolo G, Sandri M, Bottinelli R, et al. The time course of the adaptations of human muscle proteome to bed rest and the underlying mechanisms. J Physiol. 2012;590:5211-30 pubmed publisher
Chaze T, Meunier B, Chambon C, Jurie C, Picard B. Proteome dynamics during contractile and metabolic differentiation of bovine foetal muscle. Animal. 2009;3:980-1000 pubmed publisher
Guillemin N, Bonnet M, Jurie C, Picard B. Functional analysis of beef tenderness. J Proteomics. 2011;75:352-65 pubmed publisher
Uys G, Ramburan A, Loos B, Kinnear C, Korkie L, Mouton J, et al. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. BMC Cell Biol. 2011;12:18 pubmed publisher
Chang G, Liu K, Hsieh C, Hu T, Charoenfuprasert S, Liu H, et al. Identification of alpha-enolase as an autoantigen in lung cancer: its overexpression is associated with clinical outcomes. Clin Cancer Res. 2006;12:5746-54 pubmed

product information

master code :

H00002027-M01

SKU :

H00002027-M01

product name :

ENO3 Antibody (5D1) - Azide and BSA Free

unit size :

0.1 mg

description :

The ENO3 Antibody (5D1) - Azide and BSA Free from Novus is a mouse monoclonal antibody to ENO3. This antibody reacts with bovine,human,rat. The ENO3 Antibody (5D1) - Azide and BSA Free has been validated for the following applications: Cytometric Bead Assay Standard,Western Blot,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Dot Blot,Knockdown Validated,Immunocytochemistry/ Immunofluorescence.

target :

ENO3

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

5D1

conjugate :

Unconjugated

host :

Mouse

immunogen :

KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDD
PARHITGEKLG
ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Bovine,Human,Rat

specificity :

ENO3 - enolase 3 (beta, muscle)

gene symbol :

ENO3

accessionNumbers :

NP_001967

applications :

Cytometric Bead Assay Standard,Western Blot,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Dot Blot,Knockdown Validated,Immunocytochemistry/ Immunofluorescence

USD :

499 USD

alt names :

2-phospho-D-glycerate hydrolyase, 2-phospho-D-glycerate hydro-lyase, beta-enolase, EC 4.2.1, EC 4.2.1.11, Enolase 3, enolase 3 (beta, muscle), enolase 3, (beta, muscle), GSD13, MSE, Muscle-specific enolase, Skeletal muscle enolase

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage