product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
DYRK1A Antibody (7D10) - Azide and BSA Free
catalog :
H00001859-M01
quantity :
0.1 mg
price :
529 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
7D10
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
more info or order :
citations: 63
Reference
Joung J, Ma S, Tay T, Geiger Schuller K, Kirchgatterer P, Verdine V, et al. A transcription factor atlas of directed differentiation. Cell. 2023;186:209-229.e26 pubmed publisher
Pijuan I, Balducci E, Soto S xe1 nchez C, Fern xe1 ndez E, Barallobre M, Arbon xe9 s M. Impaired macroglial development and axonal conductivity contributes to the neuropathology of DYRK1A-related intellectual disability syndrome. Sci Rep. 2022;12:19912 pubmed publisher
Mumford P, Tosh J, Anderle S, Gkanatsiou Wikberg E, Lau G, Noy S, et al. Genetic Mapping of APP and Amyloid-β Biology Modulation by Trisomy 21. J Neurosci. 2022;42:6453-6468 pubmed publisher
Hawley L, Prochaska F, Stringer M, Goodlett C, Roper R. Sexually dimorphic DYRK1A overexpression on postnatal day 15 in the Ts65Dn mouse model of Down syndrome: Effects of pharmacological targeting on behavioral phenotypes. Pharmacol Biochem Behav. 2022;217:173404 pubmed publisher
Lee Walmsley D, Murray J, Dokurno P, Massey A, Benwell K, Fiumana A, et al. Fragment-Derived Selective Inhibitors of Dual-Specificity Kinases DYRK1A and DYRK1B. J Med Chem. 2021;64:8971-8991 pubmed publisher
Park C, Kim G, Lee Y, Kim H, Song M, Lee D, et al. A natural compound harmine decreases melanin synthesis through regulation of the DYRK1A/NFATC3 pathway. J Dermatol Sci. 2021;103:16-24 pubmed publisher
Weber C, Sipos M, Paczal A, Bálint B, Kun V, Foloppe N, et al. Structure-Guided Discovery of Potent and Selective DYRK1A Inhibitors. J Med Chem. 2021;64:6745-6764 pubmed publisher
Lee Y, Im E, Hyun M, Park J, Chung K. Protein phosphatase PPM1B inhibits DYRK1A kinase through dephosphorylation of pS258 and reduces toxic tau aggregation. J Biol Chem. 2021;296:100245 pubmed publisher
Fructuoso M, Gu Y, Kassis N, de Lagrán M, Dierssen M, Janel N. Ethanol-Induced Changes in Brain of Transgenic Mice Overexpressing DYRK1A. Mol Neurobiol. 2020;57:3195-3205 pubmed publisher
Roewenstrunk J, Di Vona C, Chen J, Borras E, Dong C, Arato K, et al. A comprehensive proteomics-based interaction screen that links DYRK1A to RNF169 and to the DNA damage response. Sci Rep. 2019;9:6014 pubmed publisher
Souchet B, Audrain M, Billard J, Dairou J, Fol R, Orefice N, et al. Inhibition of DYRK1A proteolysis modifies its kinase specificity and rescues Alzheimer phenotype in APP/PS1 mice. Acta Neuropathol Commun. 2019;7:46 pubmed publisher
Kyei G, Meng S, Ramani R, Niu A, Lagisetti C, Webb T, et al. Splicing Factor 3B Subunit 1 Interacts with HIV Tat and Plays a Role in Viral Transcription and Reactivation from Latency. MBio. 2018;9: pubmed publisher
Baloula V, Fructuoso M, Kassis N, Gueddouri D, Paul J, Janel N. Homocysteine-lowering gene therapy rescues signaling pathways in brain of mice with intermediate hyperhomocysteinemia. Redox Biol. 2018;19:200-209 pubmed publisher
Parras A, Anta H, Santos Galindo M, Swarup V, Elorza A, Nieto González J, et al. Autism-like phenotype and risk gene mRNA deadenylation by CPEB4 mis-splicing. Nature. 2018;560:441-446 pubmed publisher
Latour A, Gu Y, Kassis N, Daubigney F, Colin C, Gausserès B, et al. LPS-Induced Inflammation Abolishes the Effect of DYRK1A on IkB Stability in the Brain of Mice. Mol Neurobiol. 2019;56:963-975 pubmed publisher
García Cerro S, Vidal V, Lantigua S, Berciano M, Lafarga M, Ramos Cabrer P, et al. Cerebellar alterations in a model of Down syndrome: The role of the Dyrk1A gene. Neurobiol Dis. 2018;110:206-217 pubmed publisher
Audrain M, Souchet B, Alves S, Fol R, Viodé A, Haddjeri A, et al. ?APP Processing Drives Gradual Tau Pathology in an Age-Dependent Amyloid Rat Model of Alzheimer's Disease. Cereb Cortex. 2017;:1-18 pubmed publisher
Latour A, Salameh S, Carbonne C, Daubigney F, Paul J, Kergoat M, et al. Corrective effects of hepatotoxicity by hepatic Dyrk1a gene delivery in mice with intermediate hyperhomocysteinemia. Mol Genet Metab Rep. 2015;2:51-60 pubmed publisher
Janel N, Alexopoulos P, Badel A, Lamari F, Camproux A, Lagarde J, et al. Combined assessment of DYRK1A, BDNF and homocysteine levels as diagnostic marker for Alzheimer's disease. Transl Psychiatry. 2017;7:e1154 pubmed publisher
London J, Rouch C, Bui L, Assayag E, Souchet B, Daubigney F, et al. Overexpression of the DYRK1A Gene (Dual-Specificity Tyrosine Phosphorylation-Regulated Kinase 1A) Induces Alterations of the Serotoninergic and Dopaminergic Processing in Murine Brain Tissues. Mol Neurobiol. 2018;55:3822-3831 pubmed publisher
Delabar J, Latour A, Noll C, Renon M, Salameh S, Paul J, et al. One-carbon cycle alterations induced by Dyrk1a dosage. Mol Genet Metab Rep. 2014;1:487-492 pubmed
Rabaneda L, Geribaldi Doldán N, Murillo Carretero M, Carrasco M, Martínez Salas J, Verástegui C, et al. Altered regulation of the Spry2/Dyrk1A/PP2A triad by homocysteine impairs neural progenitor cell proliferation. Biochim Biophys Acta. 2016;1863:3015-3026 pubmed publisher
Glenewinkel F, Cohen M, King C, Kaspar S, Bamberg Lemper S, Mymryk J, et al. The adaptor protein DCAF7 mediates the interaction of the adenovirus E1A oncoprotein with the protein kinases DYRK1A and HIPK2. Sci Rep. 2016;6:28241 pubmed publisher
Booiman T, Loukachov V, van Dort K, van t Wout A, Kootstra N. DYRK1A Controls HIV-1 Replication at a Transcriptional Level in an NFAT Dependent Manner. PLoS ONE. 2015;10:e0144229 pubmed publisher
Kurabayashi N, Nguyen M, Sanada K. DYRK1A overexpression enhances STAT activity and astrogliogenesis in a Down syndrome mouse model. EMBO Rep. 2015;16:1548-62 pubmed publisher
Stringer M, Abeysekera I, Dria K, Roper R, Goodlett C. Low dose EGCG treatment beginning in adolescence does not improve cognitive impairment in a Down syndrome mouse model. Pharmacol Biochem Behav. 2015;138:70-9 pubmed publisher
Blazek J, Abeysekera I, Li J, Roper R. Rescue of the abnormal skeletal phenotype in Ts65Dn Down syndrome mice using genetic and therapeutic modulation of trisomic Dyrk1a. Hum Mol Genet. 2015;24:5687-96 pubmed publisher
Najas S, Arranz J, Lochhead P, Ashford A, Oxley D, Delabar J, et al. DYRK1A-mediated Cyclin D1 Degradation in Neural Stem Cells Contributes to the Neurogenic Cortical Defects in Down Syndrome. EBioMedicine. 2015;2:120-34 pubmed publisher
Thompson B, Bhansali R, Diebold L, Cook D, Stolzenburg L, Casagrande A, et al. DYRK1A controls the transition from proliferation to quiescence during lymphoid development by destabilizing Cyclin D3. J Exp Med. 2015;212:953-70 pubmed publisher
Di Vona C, Bezdan D, Islam A, Salichs E, López Bigas N, Ossowski S, et al. Chromatin-wide profiling of DYRK1A reveals a role as a gene-specific RNA polymerase II CTD kinase. Mol Cell. 2015;57:506-20 pubmed publisher
Grau C, Arató K, Fernández Fernández J, Valderrama A, Sindreu C, Fillat C, et al. DYRK1A-mediated phosphorylation of GluN2A at Ser(1048) regulates the surface expression and channel activity of GluN1/GluN2A receptors. Front Cell Neurosci. 2014;8:331 pubmed publisher
García Cerro S, Martínez P, Vidal V, Corrales A, Flórez J, Vidal R, et al. Overexpression of Dyrk1A is implicated in several cognitive, electrophysiological and neuromorphological alterations found in a mouse model of Down syndrome. PLoS ONE. 2014;9:e106572 pubmed publisher
Janel N, Sarazin M, Corlier F, Corne H, de Souza L, Hamelin L, et al. Plasma DYRK1A as a novel risk factor for Alzheimer's disease. Transl Psychiatry. 2014;4:e425 pubmed publisher
Souchet B, Latour A, Gu Y, Daubigney F, Paul J, Delabar J, et al. Molecular rescue of DYRK1A overexpression in cystathionine beta synthase-deficient mouse brain by enriched environment combined with voluntary exercise. J Mol Neurosci. 2015;55:318-23 pubmed publisher
Rachdi L, Kariyawasam D, Guez F, Aiello V, Arbones M, Janel N, et al. Dyrk1a haploinsufficiency induces diabetes in mice through decreased pancreatic beta cell mass. Diabetologia. 2014;57:960-9 pubmed publisher
Thomazeau A, Lassalle O, Iafrati J, Souchet B, Guedj F, Janel N, et al. Prefrontal deficits in a murine model overexpressing the down syndrome candidate gene dyrk1a. J Neurosci. 2014;34:1138-47 pubmed publisher
Hibaoui Y, Grad I, Letourneau A, Sailani M, Dahoun S, Santoni F, et al. Modelling and rescuing neurodevelopmental defect of Down syndrome using induced pluripotent stem cells from monozygotic twins discordant for trisomy 21. EMBO Mol Med. 2014;6:259-77 pubmed publisher
Durieu E, Chicanne G, Payrastre B, Sbrissa D, Shisheva A, Limanton E, et al. cdc-like/dual-specificity tyrosine phosphorylation-regulated kinases inhibitor leucettine L41 induces mTOR-dependent autophagy: implication for Alzheimer's disease. Mol Pharmacol. 2014;85:441-50 pubmed publisher
Pons Espinal M, Martínez de Lagrán M, Dierssen M. Environmental enrichment rescues DYRK1A activity and hippocampal adult neurogenesis in TgDyrk1A. Neurobiol Dis. 2013;60:18-31 pubmed publisher
Stefos G, Soppa U, Dierssen M, Becker W. NGF upregulates the plasminogen activation inhibitor-1 in neurons via the calcineurin/NFAT pathway and the Down syndrome-related proteins DYRK1A and RCAN1 attenuate this effect. PLoS ONE. 2013;8:e67470 pubmed publisher
Laguna A, Barallobre M, Marchena M, Mateus C, Ramírez E, Martinez Cue C, et al. Triplication of DYRK1A causes retinal structural and functional alterations in Down syndrome. Hum Mol Genet. 2013;22:2775-84 pubmed publisher
Tlili A, Jacobs F, de Koning L, Mohamed S, Bui L, Dairou J, et al. Hepatocyte-specific Dyrk1a gene transfer rescues plasma apolipoprotein A-I levels and aortic Akt/GSK3 pathways in hyperhomocysteinemic mice. Biochim Biophys Acta. 2013;1832:718-28 pubmed publisher
Arqué G, Casanovas A, Dierssen M. Dyrk1A is dynamically expressed on subsets of motor neurons and in the neuromuscular junction: possible role in Down syndrome. PLoS ONE. 2013;8:e54285 pubmed publisher
Altafaj X, Martin E, Ortiz Abalia J, Valderrama A, Lao Peregrín C, Dierssen M, et al. Normalization of Dyrk1A expression by AAV2/1-shDyrk1A attenuates hippocampal-dependent defects in the Ts65Dn mouse model of Down syndrome. Neurobiol Dis. 2013;52:117-27 pubmed publisher
Spellman C, Ahmed M, Dubach D, Gardiner K. Expression of trisomic proteins in Down syndrome model systems. Gene. 2013;512:219-25 pubmed publisher
Guo X, Kesimer M, Tolun G, Zheng X, Xu Q, Lu J, et al. The NAD(+)-dependent protein deacetylase activity of SIRT1 is regulated by its oligomeric status. Sci Rep. 2012;2:640 pubmed publisher
Abekhoukh S, Planque C, Ripoll C, Urbaniak P, Paul J, Delabar J, et al. Dyrk1A, a serine/threonine kinase, is involved in ERK and Akt activation in the brain of hyperhomocysteinemic mice. Mol Neurobiol. 2013;47:105-16 pubmed publisher
Planque C, Dairou J, Noll C, Bui L, Ripoll C, Guedj F, et al. Mice deficient in cystathionine beta synthase display increased Dyrk1A and SAHH activities in brain. J Mol Neurosci. 2013;50:1-6 pubmed publisher
Malinge S, Bliss Moreau M, Kirsammer G, Diebold L, Chlon T, Gurbuxani S, et al. Increased dosage of the chromosome 21 ortholog Dyrk1a promotes megakaryoblastic leukemia in a murine model of Down syndrome. J Clin Invest. 2012;122:948-62 pubmed publisher
Guedj F, Pereira P, Najas S, Barallobre M, Chabert C, Souchet B, et al. DYRK1A: a master regulatory protein controlling brain growth. Neurobiol Dis. 2012;46:190-203 pubmed publisher
Park J, Sung J, Park J, Song W, Chang S, Chung K. Dyrk1A negatively regulates the actin cytoskeleton through threonine phosphorylation of N-WASP. J Cell Sci. 2012;125:67-80 pubmed publisher
Ahmed M, Sturgeon X, Ellison M, Davisson M, Gardiner K. Loss of correlations among proteins in brains of the Ts65Dn mouse model of down syndrome. J Proteome Res. 2012;11:1251-63 pubmed publisher
Kida E, Walus M, Jarzabek K, Palminiello S, Albertini G, Rabe A, et al. Form of dual-specificity tyrosine-(Y)-phosphorylation-regulated kinase 1A nonphosphorylated at tyrosine 145 and 147 is enriched in the nuclei of astroglial cells, adult hippocampal progenitors, and some cholinergic axon terminals. Neuroscience. 2011;195:112-27 pubmed publisher
Sheppard O, Plattner F, Rubin A, Slender A, Linehan J, Brandner S, et al. Altered regulation of tau phosphorylation in a mouse model of down syndrome aging. Neurobiol Aging. 2012;33:828.e31-44 pubmed publisher
Toiber D, Azkona G, Ben Ari S, Toran N, Soreq H, Dierssen M. Engineering DYRK1A overdosage yields Down syndrome-characteristic cortical splicing aberrations. Neurobiol Dis. 2010;40:348-59 pubmed publisher
Guo X, Williams J, Schug T, Li X. DYRK1A and DYRK3 promote cell survival through phosphorylation and activation of SIRT1. J Biol Chem. 2010;285:13223-32 pubmed publisher
Raaf L, Noll C, Cherifi M, Benazzoug Y, Delabar J, Janel N. Hyperhomocysteinemia-induced Dyrk1a downregulation results in cardiomyocyte hypertrophy in rats. Int J Cardiol. 2010;145:306-307 pubmed publisher
Noll C, Planque C, Ripoll C, Guedj F, Diez A, Ducros V, et al. DYRK1A, a novel determinant of the methionine-homocysteine cycle in different mouse models overexpressing this Down-syndrome-associated kinase. PLoS ONE. 2009;4:e7540 pubmed publisher
Lee Y, Ha J, Kim H, Kim Y, Chang E, Song W, et al. Negative feedback Inhibition of NFATc1 by DYRK1A regulates bone homeostasis. J Biol Chem. 2009;284:33343-51 pubmed publisher
Scales T, Lin S, Kraus M, Goold R, Gordon Weeks P. Nonprimed and DYRK1A-primed GSK3 beta-phosphorylation sites on MAP1B regulate microtubule dynamics in growing axons. J Cell Sci. 2009;122:2424-35 pubmed publisher
Guedj F, Sebrie C, Rivals I, Ledru A, Paly E, Bizot J, et al. Green tea polyphenols rescue of brain defects induced by overexpression of DYRK1A. PLoS ONE. 2009;4:e4606 pubmed publisher
Hamelet J, Noll C, Ripoll C, Paul J, Janel N, Delabar J. Effect of hyperhomocysteinemia on the protein kinase DYRK1A in liver of mice. Biochem Biophys Res Commun. 2009;378:673-7 pubmed publisher
Aranda S, Alvarez M, Turró S, Laguna A, De La Luna S. Sprouty2-mediated inhibition of fibroblast growth factor signaling is modulated by the protein kinase DYRK1A. Mol Cell Biol. 2008;28:5899-911 pubmed publisher
product information
master code :
H00001859-M01
SKU :
H00001859-M01
product name :
DYRK1A Antibody (7D10) - Azide and BSA Free
unit size :
0.1 mg
description :
The DYRK1A Antibody (7D10) - Azide and BSA Free from Novus is a mouse monoclonal antibody to DYRK1A. This antibody reacts with human,mouse,rat. The DYRK1A Antibody (7D10) - Azide and BSA Free has been validated for the following applications: IF/IHC,Western Blot,Knockout Validated,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Functional,Immunocytochemistry/ Immunofluorescence.
target :
DYRK1A
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
7D10
conjugate :
Unconjugated
host :
Mouse
immunogen :
NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQET
GIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMT
GVCVQQSPVASS
DYRK1A (NP_001387, 674 a.a. ~ 763 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2b Kappa
purity :
IgG purified
species :
Human,Mouse,Rat
specificity :
DYRK1A - dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
gene symbol :
DYRK1A
accessionNumbers :
Q13627
applications :
IF/IHC,Western Blot,Knockout Validated,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Functional,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, DYRK1, MNBEC 2.7.110EC 2.7.12
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.