Dihydrofolate Reductase/DHFR Antibody (2B10) - Azide and BSA Free | Novus Biologicals H00001719-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Dihydrofolate Reductase/DHFR Antibody (2B10) - Azide and BSA Free

catalog :

H00001719-M01

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2B10

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunocytochemistry

more info or order :

Novus Biologicals product webpage

citations: 12

Reference
Huang K, Wang Y, Siu K, Zhang Y, Cai H. Targeting feed-forward signaling of TGFβ/NOX4/DHFR/eNOS uncoupling/TGFβ axis with anti-TGFβ and folic acid attenuates formation of aortic aneurysms: Novel mechanisms and therapeutics. Redox Biol. 2020;38:101757 pubmed publisher
Li Q, Youn J, Siu K, Murugesan P, Zhang Y, Cai H. Knockout of dihydrofolate reductase in mice induces hypertension and abdominal aortic aneurysm via mitochondrial dysfunction. Redox Biol. 2019;24:101185 pubmed publisher
Cai M, Zhang H, Hou L, Gao W, Song Y, Cui X, et al. Inhibiting homologous recombination decreases extrachromosomal amplification but has no effect on intrachromosomal amplification in methotrexate-resistant colon cancer cells. Int J Cancer. 2019;144:1037-1048 pubmed publisher
Steven S, Oelze M, Hanf A, Kröller Schön S, Kashani F, Roohani S, et al. The SGLT2 inhibitor empagliflozin improves the primary diabetic complications in ZDF rats. Redox Biol. 2017;13:370-385 pubmed publisher
Jabs A, Oelze M, Mikhed Y, Stamm P, KrÃ¶ller SchÃ¶n S, Welschof P, et al. Effect of soluble guanylyl cyclase activator and stimulator therapy on nitroglycerin-induced nitrate tolerance in rats. Vascul Pharmacol. 2015;71:181-91 pubmed publisher
Oelze M, Kröller Schön S, Welschof P, Jansen T, Hausding M, Mikhed Y, et al. The sodium-glucose co-transporter 2 inhibitor empagliflozin improves diabetes-induced vascular dysfunction in the streptozotocin diabetes rat model by interfering with oxidative stress and glucotoxicity. PLoS ONE. 2014;9:e112394 pubmed publisher
Kossmann S, Hu H, Steven S, SchÃ¶nfelder T, Fraccarollo D, Mikhed Y, et al. Inflammatory monocytes determine endothelial nitric-oxide synthase uncoupling and nitro-oxidative stress induced by angiotensin II. J Biol Chem. 2014;289:27540-50 pubmed publisher
Siu K, Miao X, Cai H. Recoupling of eNOS with folic acid prevents abdominal aortic aneurysm formation in angiotensin II-infused apolipoprotein E null mice. PLoS ONE. 2014;9:e88899 pubmed publisher
Bhabha G, Ekiert D, Jennewein M, Zmasek C, Tuttle L, Kroon G, et al. Divergent evolution of protein conformational dynamics in dihydrofolate reductase. Nat Struct Mol Biol. 2013;20:1243-9 pubmed publisher
Yoon S, Choi J, Kim J, Shin J, Zhang X, Kang J. Influence of reduced folate carrier and dihydrofolate reductase genes on methotrexate-induced cytotoxicity. Cancer Res Treat. 2010;42:163-71 pubmed publisher
Vodenicharov M, Laterreur N, Wellinger R. Telomere capping in non-dividing yeast cells requires Yku and Rap1. EMBO J. 2010;29:3007-19 pubmed publisher
Ionova I, Vasquez Vivar J, Whitsett J, Herrnreiter A, Medhora M, Cooley B, et al. Deficient BH4 production via de novo and salvage pathways regulates NO responses to cytokines in adult cardiac myocytes. Am J Physiol Heart Circ Physiol. 2008;295:H2178-87 pubmed publisher

product information

master code :

H00001719-M01

SKU :

H00001719-M01

product name :

Dihydrofolate Reductase/DHFR Antibody (2B10) - Azide and BSA Free

unit size :

0.1 mg

description :

The Dihydrofolate Reductase/DHFR Antibody (2B10) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Dihydrofolate Reductase/DHFR. This antibody reacts with human,mouse,rat,yeast. The Dihydrofolate Reductase/DHFR Antibody (2B10) - Azide and BSA Free has been validated for the following applications: Western Blot,ELISA,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence.

target :

Dihydrofolate Reductase/DHFR

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

2B10

conjugate :

Unconjugated

host :

Mouse

immunogen :

HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAM
NHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPG
VLSDVQEEKGIKYKFEVYEKND
DHFR (AAH03584, 88 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

Protein A purified

species :

Human,Mouse,Rat,Yeast

specificity :

DHFR (2B10)

gene symbol :

DHFR

accessionNumbers :

AAH03584

applications :

Western Blot,ELISA,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence

USD :

499 USD

alt names :

DHFRP1, dihydrofolate reductase, DYR, EC 1.5.1.3

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage