product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Cathepsin K Antibody (2F1) - Azide and BSA Free
catalog :
H00001513-M01
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2F1
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
product information
master code :
H00001513-M01
SKU :
H00001513-M01
product name :
Cathepsin K Antibody (2F1) - Azide and BSA Free
unit size :
0.1 mg
description :
The Cathepsin K Antibody (2F1) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Cathepsin K. This antibody reacts with human. The Cathepsin K Antibody (2F1) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
Cathepsin K
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
2F1
conjugate :
Unconjugated
host :
Mouse
immunogen :
KCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQF
YSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNS
WGENWGNKGYILMARNKNNACGIANLASFPKM
CTSK (AAH16058, 220 a.a. ~ 329 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
YSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNS
WGENWGNKGYILMARNKNNACGIANLASFPKM
CTSK (AAH16058, 220 a.a. ~ 329 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human
specificity :
CTSK (2F1)
gene symbol :
CTSK
accessionNumbers :
AAH16058
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
