Cystathionase Antibody (S51) - Azide and BSA Free | Novus Biologicals H00001491-M03 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Cystathionase Antibody (S51) - Azide and BSA Free

catalog :

H00001491-M03

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

S51

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 14

Reference
Wang Y, Huang J, Chen W, Wang R, Kao M, Pan Y, et al. Dysregulation of cystathionine γ-lyase promotes prostate cancer progression and metastasis. EMBO Rep. 2019;20:e45986 pubmed publisher
Merz T, Wepler M, Nußbaum B, Vogt J, Calzia E, Wang R, et al. Cystathionine-γ-lyase expression is associated with mitochondrial respiration during sepsis-induced acute kidney injury in swine with atherosclerosis. Intensive Care Med Exp. 2018;6:43 pubmed publisher
Seale L, Ha H, Hashimoto A, Berry M. Relationship between selenoprotein P and selenocysteine lyase: Insights into selenium metabolism. Free Radic Biol Med. 2018;127:182-189 pubmed publisher
Lee J, Kang E, Kobayashi S, Homma T, Sato H, Seo H, et al. The viability of primary hepatocytes is maintained under a low cysteine-glutathione redox state with a marked elevation in ophthalmic acid production. Exp Cell Res. 2017;361:178-191 pubmed publisher
Kobayashi S, Lee J, Takao T, Fujii J. Increased ophthalmic acid production is supported by amino acid catabolism under fasting conditions in mice. Biochem Biophys Res Commun. 2017;491:649-655 pubmed publisher
Kurahashi T, Lee J, Nabeshima A, Homma T, Kang E, Saito Y, et al. Ascorbic acid prevents acetaminophen-induced hepatotoxicity in mice by ameliorating glutathione recovery and autophagy. Arch Biochem Biophys. 2016;604:36-46 pubmed publisher
Ohmura M, Hishiki T, Yamamoto T, Nakanishi T, Kubo A, Tsuchihashi K, et al. Impacts of CD44 knockdown in cancer cells on tumor and host metabolic systems revealed by quantitative imaging mass spectrometry. Nitric Oxide. 2015;46:102-13 pubmed publisher
Bucci M, Papapetropoulos A, Vellecco V, Zhou Z, Zaid A, Giannogonas P, et al. cGMP-dependent protein kinase contributes to hydrogen sulfide-stimulated vasorelaxation. PLoS ONE. 2012;7:e53319 pubmed publisher
Zhang L, Yang G, Untereiner A, Ju Y, Wu L, Wang R. Hydrogen sulfide impairs glucose utilization and increases gluconeogenesis in hepatocytes. Endocrinology. 2013;154:114-26 pubmed publisher
Streeter E, Hart J, Badoer E. An investigation of the mechanisms of hydrogen sulfide-induced vasorelaxation in rat middle cerebral arteries. Naunyn Schmiedebergs Arch Pharmacol. 2012;385:991-1002 pubmed publisher
Guo H, Gai J, Wang Y, Jin H, Du J, Jin J. Characterization of hydrogen sulfide and its synthases, cystathionine ?-synthase and cystathionine ?-lyase, in human prostatic tissue and cells. Urology. 2012;79:483.e1-5 pubmed publisher
Pei Y, Wu B, Cao Q, Wu L, Yang G. Hydrogen sulfide mediates the anti-survival effect of sulforaphane on human prostate cancer cells. Toxicol Appl Pharmacol. 2011;257:420-8 pubmed publisher
Zhu X, Liu S, Liu Y, Wang S, Ni X. Glucocorticoids suppress cystathionine gamma-lyase expression and H2S production in lipopolysaccharide-treated macrophages. Cell Mol Life Sci. 2010;67:1119-32 pubmed publisher
Siebert N, Cantré D, Eipel C, Vollmar B. H2S contributes to the hepatic arterial buffer response and mediates vasorelaxation of the hepatic artery via activation of K(ATP) channels. Am J Physiol Gastrointest Liver Physiol. 2008;295:G1266-73 pubmed publisher

product information

master code :

H00001491-M03

SKU :

H00001491-M03

product name :

Cystathionase Antibody (S51) - Azide and BSA Free

unit size :

0.1 mg

description :

The Cystathionase Antibody (S51) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Cystathionase. This antibody reacts with human,mouse,porcine,rat. The Cystathionase Antibody (S51) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence.

target :

Cystathionase

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

S51

conjugate :

Unconjugated

host :

Mouse

immunogen :

MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVP
PISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAAL
DGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGT
NRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWI
ETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYF
QRPLALGADISMYSATKYMNGRSDVVMGLVSVNCESLHN
RLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNG
MAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTG
MVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELP
AIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDL
DQALKAAHPPSGSHS
CTH (AAH15807, 1 a.a. ~ 405 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human,Mouse,Porcine,Rat

specificity :

CTH - cystathionase (cystathionine gamma-lyase)

gene symbol :

CTH

accessionNumbers :

AAH15807

applications :

ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence

USD :

499 USD

alt names :

cystathionase (cystathionine gamma-lyase), cystathionine gamma-lyase, cysteine desulfhydrase, EC 4.4.1, EC 4.4.1.1, gamma-cystathionase, homoserine deaminase, homoserine dehydratase, MGC9471

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage