Cystathionase Antibody (4E1-1B7) - Azide and BSA Free | Novus Biologicals H00001491-M01-100ug product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Cystathionase Antibody (4E1-1B7) - Azide and BSA Free

catalog :

H00001491-M01-100ug

quantity :

100 ug

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4E1-1B7

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 32

Reference
Bok R, Guerra D, Lorca R, Wennersten S, Harris P, Rauniyar A, et al. Cystathionine γ-lyase promotes estrogen-stimulated uterine artery blood flow via glutathione homeostasis. Redox Biol. 2021;40:101827 pubmed publisher
Jin Z, Zhang Q, Wondimu E, Verma R, Fu M, Shuang T, et al. H2S-stimulated bioenergetics in chicken erythrocytes and the underlying mechanism. Am J Physiol Regul Integr Comp Physiol. 2020;319:R69-R78 pubmed publisher
Novera W, Lee Z, Nin D, Dai M, Binte Idres S, Wu H, et al. Cysteine Deprivation Targets Ovarian Clear Cell Carcinoma Via Oxidative Stress and Iron-Sulfur Cluster Biogenesis Deficit. Antioxid Redox Signal. 2020;: pubmed publisher
Akahoshi N, Minakawa T, Miyashita M, Sugiyama U, Saito C, Takemoto R, et al. Increased Urinary 3-Mercaptolactate Excretion and Enhanced Passive Systemic Anaphylaxis in Mice Lacking Mercaptopyruvate Sulfurtransferase, a Model of Mercaptolactate-Cysteine Disulfiduria. Int J Mol Sci. 2020;21: pubmed publisher
Xu J, Gao D, Peng L, Qiu Z, Ke L, Zhu Y, et al. The gasotransmitter hydrogen sulfide inhibits transepithelial anion secretion of pregnant mouse endometrial epithelium. Nitric Oxide. 2019;: pubmed publisher
Gambari L, Amore E, Raggio R, Bonani W, Barone M, Lisignoli G, et al. Hydrogen sulfide-releasing silk fibroin scaffold for bone tissue engineering. Mater Sci Eng C Mater Biol Appl. 2019;102:471-482 pubmed publisher
Yuan Y, Wang Y, Yuan B, Yuan X, Hou X, Bian J, et al. Impaired CBS-H2S signaling axis contributes to MPTP-induced neurodegeneration in a mouse model of Parkinson's disease. Brain Behav Immun. 2018;67:77-90 pubmed publisher
Mitidieri E, Tramontano T, Gurgone D, Imbimbo C, Mirone V, Fusco F, et al. ?3 adrenergic receptor activation relaxes human corpus cavernosum and penile artery through a hydrogen sulfide/cGMP-dependent mechanism. Pharmacol Res. 2017;124:100-104 pubmed publisher
Nußbaum B, McCook O, Hartmann C, Matallo J, Wepler M, Antonucci E, et al. Left ventricular function during porcine-resuscitated septic shock with pre-existing atherosclerosis. Intensive Care Med Exp. 2016;4:14 pubmed publisher
Li J, Li Q, Du H, Wang Y, You S, Wang F, et al. Homocysteine Triggers Inflammatory Responses in Macrophages through Inhibiting CSE-H2S Signaling via DNA Hypermethylation of CSE Promoter. Int J Mol Sci. 2015;16:12560-77 pubmed publisher
Xu Y, Du H, Li J, Xu R, Wang Y, You S, et al. Statins upregulate cystathionine ?-lyase transcription and H2S generation via activating Akt signaling in macrophage. Pharmacol Res. 2014;87:18-25 pubmed publisher
Ida T, Sawa T, Ihara H, Tsuchiya Y, Watanabe Y, Kumagai Y, et al. Reactive cysteine persulfides and S-polythiolation regulate oxidative stress and redox signaling. Proc Natl Acad Sci U S A. 2014;111:7606-11 pubmed publisher
Badiei A, Rivers Auty J, Ang A, Bhatia M. Inhibition of hydrogen sulfide production by gene silencing attenuates inflammatory activity of LPS-activated RAW264.7 cells. Appl Microbiol Biotechnol. 2013;97:7845-52 pubmed publisher
Mani S, Li H, Untereiner A, Wu L, Yang G, Austin R, et al. Decreased endogenous production of hydrogen sulfide accelerates atherosclerosis. Circulation. 2013;127:2523-34 pubmed publisher
Cindrova Davies T, Herrera E, Niu Y, Kingdom J, Giussani D, Burton G. Reduced cystathionine ?-lyase and increased miR-21 expression are associated with increased vascular resistance in growth-restricted pregnancies: hydrogen sulfide as a placental vasodilator. Am J Pathol. 2013;182:1448-58 pubmed publisher
Bucci M, Papapetropoulos A, Vellecco V, Zhou Z, Zaid A, Giannogonas P, et al. cGMP-dependent protein kinase contributes to hydrogen sulfide-stimulated vasorelaxation. PLoS ONE. 2012;7:e53319 pubmed publisher
Yang G, Zhao K, Ju Y, Mani S, Cao Q, Puukila S, et al. Hydrogen sulfide protects against cellular senescence via S-sulfhydration of Keap1 and activation of Nrf2. Antioxid Redox Signal. 2013;18:1906-19 pubmed publisher
Fu M, Zhang W, Yang G, Wang R. Is cystathionine gamma-lyase protein expressed in the heart?. Biochem Biophys Res Commun. 2012;428:469-74 pubmed publisher
Wu B, Teng H, Yang G, Wu L, Wang R. Hydrogen sulfide inhibits the translational expression of hypoxia-inducible factor-1?. Br J Pharmacol. 2012;167:1492-505 pubmed publisher
Dufton N, Natividad J, Verdu E, Wallace J. Hydrogen sulfide and resolution of acute inflammation: A comparative study utilizing a novel fluorescent probe. Sci Rep. 2012;2:499 pubmed publisher
Holwerda K, Bos E, Rajakumar A, Ris Stalpers C, van Pampus M, Timmer A, et al. Hydrogen sulfide producing enzymes in pregnancy and preeclampsia. Placenta. 2012;33:518-21 pubmed publisher
Yang G, Li H, Tang G, Wu L, Zhao K, Cao Q, et al. Increased neointimal formation in cystathionine gamma-lyase deficient mice: role of hydrogen sulfide in ?5?1-integrin and matrix metalloproteinase-2 expression in smooth muscle cells. J Mol Cell Cardiol. 2012;52:677-88 pubmed publisher
Li X, Mao X, Hei R, Zhang Z, Wen L, Zhang P, et al. Protective role of hydrogen sulfide against noise-induced cochlear damage: a chronic intracochlear infusion model. PLoS ONE. 2011;6:e26728 pubmed publisher
Yang G, Pei Y, Cao Q, Wang R. MicroRNA-21 represses human cystathionine gamma-lyase expression by targeting at specificity protein-1 in smooth muscle cells. J Cell Physiol. 2012;227:3192-200 pubmed publisher
Yang G, Pei Y, Teng H, Cao Q, Wang R. Specificity protein-1 as a critical regulator of human cystathionine gamma-lyase in smooth muscle cells. J Biol Chem. 2011;286:26450-60 pubmed publisher
Kasparek M, Linden D, Farrugia G, Sarr M. Hydrogen sulfide modulates contractile function in rat jejunum. J Surg Res. 2012;175:234-42 pubmed publisher
Martin G, McKnight G, Dicay M, Coffin C, Ferraz J, Wallace J. Hydrogen sulphide synthesis in the rat and mouse gastrointestinal tract. Dig Liver Dis. 2010;42:103-9 pubmed publisher
Wallace J, Vong L, McKnight W, Dicay M, Martin G. Endogenous and exogenous hydrogen sulfide promotes resolution of colitis in rats. Gastroenterology. 2009;137:569-78, 578.e1 pubmed publisher
Feng X, Chen Y, Zhao J, Tang C, Jiang Z, Geng B. Hydrogen sulfide from adipose tissue is a novel insulin resistance regulator. Biochem Biophys Res Commun. 2009;380:153-9 pubmed publisher
Fu Z, Liu X, Geng B, Fang L, Tang C. Hydrogen sulfide protects rat lung from ischemia-reperfusion injury. Life Sci. 2008;82:1196-202 pubmed publisher
Wallace J, Dicay M, McKnight W, Martin G. Hydrogen sulfide enhances ulcer healing in rats. FASEB J. 2007;21:4070-6 pubmed
Schicho R, Krueger D, Zeller F, Von Weyhern C, Frieling T, Kimura H, et al. Hydrogen sulfide is a novel prosecretory neuromodulator in the Guinea-pig and human colon. Gastroenterology. 2006;131:1542-52 pubmed

product information

master code :

H00001491-M01

SKU :

H00001491-M01-100ug

product name :

Cystathionase Antibody (4E1-1B7) - Azide and BSA Free

unit size :

100 ug

description :

The Cystathionase Antibody (4E1-1B7) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Cystathionase. This antibody reacts with guinea pig,human,mouse,porcine,rat. The Cystathionase Antibody (4E1-1B7) - Azide and BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

Cystathionase

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

4E1-1B7

conjugate :

Unconjugated

host :

Mouse

immunogen :

MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVP
PISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAAL
DGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGT
NRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWI
ETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYF
QRPLALGADISMYSATKYMNGRSDVVMGLVSVNCESLHN
RLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNG
MAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTG
MVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELP
AIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDL
DQALKAAHPPSGSHS
CTH (AAH15807, 1 a.a. ~ 405 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Guinea Pig,Human,Mouse,Porcine,Rat

specificity :

CTH - cystathionase (cystathionine gamma-lyase)

gene symbol :

CTH

accessionNumbers :

AAH15807

applications :

IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

529 USD

alt names :

cystathionase (cystathionine gamma-lyase), cystathionine gamma-lyase, cysteine desulfhydrase, EC 4.4.1, EC 4.4.1.1, gamma-cystathionase, homoserine deaminase, homoserine dehydratase, MGC9471

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage