CSE1L/CAS/Exportin-2 Antibody (3D8) - Azide and BSA Free | Novus Biologicals H00001434-M08 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

CSE1L/CAS/Exportin-2 Antibody (3D8) - Azide and BSA Free

catalog :

H00001434-M08

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3D8

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Lee W, Shen S, Wu P, Chou C, Shih Y, Yeh C, et al. CSE1L Links cAMP/PKA and Ras/ERK pathways and regulates the expressions and phosphorylations of ERK1/2, CREB, and MITF in melanoma cells. Mol Carcinog. 2016;55:1542-1552 pubmed publisher
Okimoto S, Sun J, Fukuto A, Horikoshi Y, Matsuda S, Matsuda T, et al. hCAS/CSE1L regulates RAD51 distribution and focus formation for homologous recombinational repair. Genes Cells. 2015;20:681-94 pubmed publisher
Lee W, Shen S, Shih Y, Chou C, Tseng J, Chin S, et al. Early decline in serum phospho-CSE1L levels in vemurafenib/sunitinib-treated melanoma and sorafenib/lapatinib-treated colorectal tumor xenografts. J Transl Med. 2015;13:191 pubmed publisher
Chin S, Wu P, Shih Y, Yeh C, Lee W, Shen S, et al. High expression of cytoplasmic phosphorylated CSE1L in malignant melanoma but not in benign nevi: phosphorylated CSE1L for the discrimination between melanoma and benign nevi. Int J Clin Exp Pathol. 2015;8:1393-401 pubmed
Jiang M, Yeh C, Tai C, Chen H, Lin S, Su T, et al. CSE1L modulates Ras-induced cancer cell invasion: correlation of K-Ras mutation and CSE1L expression in colorectal cancer progression. Am J Surg. 2013;206:418-27 pubmed publisher
Li K, Yang L, Pang J, Chan A, Zhou L, Mao Y, et al. MIR-137 suppresses growth and invasion, is downregulated in oligodendroglial tumors and targets CSE1L. Brain Pathol. 2013;23:426-39 pubmed publisher
Chang C, Tai C, Su T, Shen K, Lin S, Yeh C, et al. The prognostic significance of nuclear CSE1L in urinary bladder urothelial carcinomas. Ann Diagn Pathol. 2012;16:362-8 pubmed publisher
Uen W, Tai C, Shen S, Lee W, Tsao T, Deng W, et al. Differential distributions of CSE1L/CAS and E-cadherin in the polarized and non-polarized epithelial glands of neoplastic colorectal epithelium. J Mol Histol. 2010;41:259-66 pubmed publisher
Stella Tsai C, Chen H, Tung J, Tsou S, Tsao T, Liao C, et al. Serum cellular apoptosis susceptibility protein is a potential prognostic marker for metastatic colorectal cancer. Am J Pathol. 2010;176:1619-28 pubmed publisher
Tung M, Tsai C, Tung J, Tsao T, Chen H, Yeh K, et al. Higher prevalence of secretory CSE1L/CAS in sera of patients with metastatic cancer. Cancer Epidemiol Biomarkers Prev. 2009;18:1570-7 pubmed publisher
Tsao T, Tsai C, Tung J, Chen S, Yue C, Liao C, et al. Function of CSE1L/CAS in the secretion of HT-29 human colorectal cells and its expression in human colon. Mol Cell Biochem. 2009;327:163-70 pubmed publisher

product information

master code :

H00001434-M08

SKU :

H00001434-M08

product name :

CSE1L/CAS/Exportin-2 Antibody (3D8) - Azide and BSA Free

unit size :

0.1 mg

description :

The CSE1L/CAS/Exportin-2 Antibody (3D8) - Azide and BSA Free from Novus is a mouse monoclonal antibody to CSE1L/CAS/Exportin-2. This antibody reacts with human,mouse. The CSE1L/CAS/Exportin-2 Antibody (3D8) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

CSE1L/CAS/Exportin-2

category :

Primary Antibodies

buffer :

PBS, pH 7.4

clonality :

Monoclonal

clone :

3D8

conjugate :

Unconjugated

host :

Mouse

immunogen :

LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAG
KKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVST
SLNAEALQYLQGYLQAARVTLL
CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human,Mouse

specificity :

CSE1L - CSE1 chromosome segregation 1-like (yeast)

gene symbol :

CSE1L

accessionNumbers :

NP_001307

applications :

ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

CASMGC117283, Cellular apoptosis susceptibility protein, chromosome segregation 1 (yeast homolog)-like, Chromosome segregation 1-like protein, CSE1, CSE1 chromosome segregation 1-like (yeast), CSE1L, Exp2, exportin-2, Importin-alpha re-exporter, MGC130037, XPO2MGC130036

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage