mu Crystallin Antibody (6B3) - Azide and BSA Free | Novus Biologicals H00001428-M03 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

mu Crystallin Antibody (6B3) - Azide and BSA Free

catalog :

H00001428-M03

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6B3

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Schnoell J, Kotowski U, Jank B, Stoiber S, Gurnhofer E, Schlederer M, et al. Prognostic Relevance of Thyroid-Hormone-Associated Proteins in Adenoid Cystic Carcinoma of the Head and Neck. J Pers Med. 2021;11: pubmed publisher
Jank B, Haas M, Schnoell J, Schlederer M, Heiduschka G, Kenner L, et al. µ-Crystallin Is Associated with Disease Outcome in Head and Neck Squamous Cell Carcinoma. J Pers Med. 2021;11: pubmed publisher
Kinney C, O Neill A, Noland K, Huang W, Muriel J, Lukyanenko V, et al. μ-Crystallin in Mouse Skeletal Muscle Promotes a Shift from Glycolytic toward Oxidative Metabolism. Curr Res Physiol. 2021;4:47-59 pubmed publisher
Vanderplanck C, Tassin A, Ansseau E, Charron S, Wauters A, Lancelot C, et al. Overexpression of the double homeodomain protein DUX4c interferes with myofibrillogenesis and induces clustering of myonuclei. Skelet Muscle. 2018;8:2 pubmed publisher
Dilwali S, Lysaght A, Roberts D, Barker F, McKenna M, Stankovic K. Sporadic vestibular schwannomas associated with good hearing secrete higher levels of fibroblast growth factor 2 than those associated with poor hearing irrespective of tumor size. Otol Neurotol. 2013;34:748-54 pubmed publisher
Vanderplanck C, Ansseau E, Charron S, Stricwant N, Tassin A, Laoudj Chenivesse D, et al. The FSHD atrophic myotube phenotype is caused by DUX4 expression. PLoS ONE. 2011;6:e26820 pubmed publisher
Mathur B, Caprioli R, Deutch A. Proteomic analysis illuminates a novel structural definition of the claustrum and insula. Cereb Cortex. 2009;19:2372-9 pubmed publisher
Reed P, Corse A, Porter N, Flanigan K, Bloch R. Abnormal expression of mu-crystallin in facioscapulohumeral muscular dystrophy. Exp Neurol. 2007;205:583-6 pubmed

product information

master code :

H00001428-M03

SKU :

H00001428-M03

product name :

mu Crystallin Antibody (6B3) - Azide and BSA Free

unit size :

0.1 mg

description :

The mu Crystallin Antibody (6B3) - Azide and BSA Free from Novus is a mouse monoclonal antibody to mu Crystallin. This antibody reacts with human,mouse. The mu Crystallin Antibody (6B3) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin.

target :

mu Crystallin

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

6B3

conjugate :

Unconjugated

host :

Mouse

immunogen :

EWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEA
ALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKS
LGMAVEDTVAAKLIYDSWSSGK
CRYM (NP_001879, 215 a.a. ~ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

Protein A purified

species :

Human,Mouse

specificity :

CRYM (6B3)

gene symbol :

CRYM

accessionNumbers :

NP_001879

applications :

ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin

USD :

529 USD

alt names :

crystallin, mu, DFNA40NADP-regulated thyroid-hormone binding protein, mu-crystallin homolog, NADP-regulated thyroid-hormone-binding protein, THBP

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage