CRX/CORD2 Antibody (4G11) - Azide and BSA Free | Novus Biologicals H00001406-M02 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

CRX/CORD2 Antibody (4G11) - Azide and BSA Free

catalog :

H00001406-M02

quantity :

0.1 mg

price :

539 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4G11

reactivity :

human, mouse, bovine

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, flow cytometry, chromatin immunoprecipitation, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 32

Reference
Langou xeb t M, Jolicoeur C, Javed A, Mattar P, Gearhart M, Daiger S, et al. Mutations in BCOR, a co-repressor of CRX/OTX2, are associated with early-onset retinal degeneration. Sci Adv. 2022;8:eabh2868 pubmed publisher
Rai D, Iwanami M, Takahashi Y, Komuta Y, Aoi N, Umezawa A, et al. Evaluation of photoreceptor-directed fibroblasts derived from retinitis pigmentosa patients with defects in the EYS gene: a possible cost-effective cellular model for mechanism-oriented drug. Stem Cell Res Ther. 2022;13:157 pubmed publisher
Zhang X, Zhang B, Xiang L, Wu H, Alexander S, Zhou P, et al. MLL5 is involved in retinal photoreceptor maturation through facilitating CRX-mediated photoreceptor gene transactivation. iScience. 2022;25:104058 pubmed publisher
Chu H, Rebustini I, Becerra S, Wang Y. Pigment epithelium-derived factor engineered to increase glycosaminoglycan affinity while maintaining bioactivity. Biochem Biophys Res Commun. 2022;605:148-153 pubmed publisher
Lyu P, Hoang T, Santiago C, Thomas E, Timms A, Appel H, et al. Gene regulatory networks controlling temporal patterning, neurogenesis, and cell-fate specification in mammalian retina. Cell Rep. 2021;37:109994 pubmed publisher
Li Y, Deng W, Jin Z. Modeling retinitis pigmentosa through patient-derived retinal organoids. STAR Protoc. 2021;2:100438 pubmed publisher
Too L, Shen W, Mammo Z, Osaadon P, Gillies M, Simunovic M. SURGICAL RETINAL EXPLANTS AS A SOURCE OF RETINAL PROGENITOR CELLS. Retina. 2021;41:1986-1993 pubmed publisher
D xf6 pper H, Menges J, Bozet M, Brenzel A, Lohmann D, Steenpass L, et al. Differentiation Protocol for 3D Retinal Organoids, Immunostaining and Signal Quantitation. Curr Protoc Stem Cell Biol. 2020;55:e120 pubmed publisher
Gao M, Lei X, Han F, He K, Jin S, Zhang Y, et al. Patient-Specific Retinal Organoids Recapitulate Disease Features of Late-Onset Retinitis Pigmentosa. Front Cell Dev Biol. 2020;8:128 pubmed publisher
Garita Hernandez M, Routet F, Guibbal L, Khabou H, Toualbi L, Riancho L, et al. AAV-Mediated Gene Delivery to 3D Retinal Organoids Derived from Human Induced Pluripotent Stem Cells. Int J Mol Sci. 2020;21: pubmed publisher
Chichagova V, Dorgau B, Felemban M, Georgiou M, Armstrong L, Lako M. Differentiation of Retinal Organoids from Human Pluripotent Stem Cells. Curr Protoc Stem Cell Biol. 2019;50:e95 pubmed publisher
Chemla Y, Betzer O, Markus A, Farah N, Motiei M, Popovtzer R, et al. Gold nanoparticles for multimodal high-resolution imaging of transplanted cells for retinal replacement therapy. Nanomedicine (Lond). 2019;14:1857-1871 pubmed publisher
Markus A, Shamul A, Chemla Y, Farah N, Shaham L, Goldstein R, et al. An optimized protocol for generating labeled and transplantable photoreceptor precursors from human embryonic stem cells. Exp Eye Res. 2019;180:29-38 pubmed publisher
Gagliardi G, Ben M Barek K, Chaffiol A, Slembrouck Brec A, Conart J, Nanteau C, et al. Characterization and Transplantation of CD73-Positive Photoreceptors Isolated from Human iPSC-Derived Retinal Organoids. Stem Cell Reports. 2018;11:665-680 pubmed publisher
Mattar P, Stevanovic M, Nad I, Cayouette M. Casz1 controls higher-order nuclear organization in rod photoreceptors. Proc Natl Acad Sci U S A. 2018;115:E7987-E7996 pubmed publisher
Felemban M, Dorgau B, Hunt N, Hallam D, Zerti D, Bauer R, et al. Extracellular matrix component expression in human pluripotent stem cell-derived retinal organoids recapitulates retinogenesis in vivo and reveals an important role for IMPG1 and CD44 in the development of photoreceptors and interphotoreceptor matrix. Acta Biomater. 2018;74:207-221 pubmed publisher
Izuogu O, Alhasan A, Mellough C, Collin J, Gallon R, Hyslop J, et al. Analysis of human ES cell differentiation establishes that the dominant isoforms of the lncRNAs RMST and FIRRE are circular. BMC Genomics. 2018;19:276 pubmed publisher
Elsaeidi F, MacPherson P, Mills E, Jui J, Flannery J, Goldman D. Notch Suppression Collaborates with Ascl1 and Lin28 to Unleash a Regenerative Response in Fish Retina, But Not in Mice. J Neurosci. 2018;38:2246-2261 pubmed publisher
Lu A, Barnstable C. Generation of Photoreceptor Precursors from Mouse Embryonic Stem Cells. Stem Cell Rev. 2018;14:247-261 pubmed publisher
Sluch V, Davis C, Ranganathan V, Kerr J, Krick K, Martin R, et al. Differentiation of human ESCs to retinal ganglion cells using a CRISPR engineered reporter cell line. Sci Rep. 2015;5:16595 pubmed publisher
Khan M, Walters L, Li Q, Thomas D, Miller J, Zhang Q, et al. Characterization and pharmacologic targeting of EZH2, a fetal retinal protein and epigenetic regulator, in human retinoblastoma. Lab Invest. 2015;95:1278-90 pubmed publisher
Ohlemacher S, Iglesias C, Sridhar A, Gamm D, Meyer J. Generation of highly enriched populations of optic vesicle-like retinal cells from human pluripotent stem cells. Curr Protoc Stem Cell Biol. 2015;32:1H.8.1-20 pubmed publisher
Reichman S, Goureau O. Production of Retinal Cells from Confluent Human iPS Cells. Methods Mol Biol. 2016;1357:339-51 pubmed publisher
Xie B, Zhang X, Hashimoto T, Tien A, Chen A, Ge J, et al. Differentiation of retinal ganglion cells and photoreceptor precursors from mouse induced pluripotent stem cells carrying an Atoh7/Math5 lineage reporter. PLoS ONE. 2014;9:e112175 pubmed publisher
Masuda T, Zhang X, Berlinicke C, Wan J, Yerrabelli A, Conner E, et al. The transcription factor GTF2IRD1 regulates the topology and function of photoreceptors by modulating photoreceptor gene expression across the retina. J Neurosci. 2014;34:15356-68 pubmed publisher
Reichman S, Terray A, Slembrouck A, Nanteau C, Orieux G, Habeler W, et al. From confluent human iPS cells to self-forming neural retina and retinal pigmented epithelium. Proc Natl Acad Sci U S A. 2014;111:8518-23 pubmed publisher
Tran N, Zhang A, Zhang X, Huecker J, Hennig A, Chen S. Mechanistically distinct mouse models for CRX-associated retinopathy. PLoS Genet. 2014;10:e1004111 pubmed publisher
Jayaram H, Jones M, Eastlake K, Cottrill P, Becker S, Wiseman J, et al. Transplantation of photoreceptors derived from human Muller glia restore rod function in the P23H rat. Stem Cells Transl Med. 2014;3:323-33 pubmed publisher
Carr A, Vugler A, Yu L, Semo M, Coffey P, Moss S, et al. The expression of retinal cell markers in human retinal pigment epithelial cells and their augmentation by the synthetic retinoid fenretinide. Mol Vis. 2011;17:1701-15 pubmed
Sakagami K, Gan L, Yang X. Distinct effects of Hedgehog signaling on neuronal fate specification and cell cycle progression in the embryonic mouse retina. J Neurosci. 2009;29:6932-44 pubmed publisher
Esumi N, Kachi S, Hackler L, Masuda T, Yang Z, Campochiaro P, et al. BEST1 expression in the retinal pigment epithelium is modulated by OTX family members. Hum Mol Genet. 2009;18:128-41 pubmed publisher
Peng G, Chen S. Crx activates opsin transcription by recruiting HAT-containing co-activators and promoting histone acetylation. Hum Mol Genet. 2007;16:2433-52 pubmed

product information

master code :

H00001406-M02

SKU :

H00001406-M02

product name :

CRX/CORD2 Antibody (4G11) - Azide and BSA Free

unit size :

0.1 mg

description :

The CRX/CORD2 Antibody (4G11) - Azide and BSA Free from Novus is a mouse monoclonal antibody to CRX/CORD2. This antibody reacts with bovine,fish,human,mouse. The CRX/CORD2 Antibody (4G11) - Azide and BSA Free has been validated for the following applications: Immunohistochemistry,Immunocytochemistry/ Immunofluorescence,Chemotaxis,Flow Cytometry,ELISA,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Chromatin Immunoprecipitation (ChIP).

target :

CRX/CORD2

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

4G11

conjugate :

Unconjugated

host :

Mouse

immunogen :

MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQ
RRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINL
PESRVQVWFKNRRAKCR
CRX (NP_000545, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Bovine,Fish,Human,Mouse

specificity :

CRX - cone-rod homeobox

gene symbol :

CRX

accessionNumbers :

NP_000545

applications :

Immunohistochemistry,Immunocytochemistry/ Immunofluorescence,Chemotaxis,Flow Cytometry,ELISA,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Chromatin Immunoprecipitation (ChIP)

USD :

539 USD

alt names :

cone-rod homeobox, CORD2, CRDcone-rod homeobox protein, LCA7orthodenticle homeobox 3, OTX3

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage