product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
CLTB Antibody (4B12-1E3) - Azide and BSA Free
catalog :
H00001212-M01
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4B12-1E3
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
product information
master code :
H00001212-M01
SKU :
H00001212-M01
product name :
CLTB Antibody (4B12-1E3) - Azide and BSA Free
unit size :
0.1 mg
description :
The CLTB Antibody (4B12-1E3) - Azide and BSA Free from Novus is a mouse monoclonal antibody to CLTB. This antibody reacts with human. The CLTB Antibody (4B12-1E3) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
CLTB
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
4B12-1E3
conjugate :
Unconjugated
host :
Mouse
immunogen :
MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIE
NDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQ
EANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQEL
DAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRA
SEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVS
RLRSVLMSLKQTPLSR
CLTB (AAH06457, 1 a.a. ~ 211 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
NDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQ
EANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQEL
DAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRA
SEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVS
RLRSVLMSLKQTPLSR
CLTB (AAH06457, 1 a.a. ~ 211 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2b Kappa
purity :
IgG purified
species :
Human
specificity :
CLTB - clathrin, light polypeptide (Lcb)
gene symbol :
CLTB
accessionNumbers :
AAH06457
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
clathrin light chain B, clathrin, light chain (Lcb), clathrin, light chain B, clathrin, light polypeptide (Lcb), Lcb
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
browse more products
- Rad1 Antibody (1G2) - Azide and BSA Free | H00005810-M01J-0.1mg
- Triosephosphate isomerase Antibody (1D10-2E2) - Azide and BSA Free | H00007167-M01
- ANP32A Antibody (2G11-4A5) - Azide and BSA Free | H00008125-M01
- XAB2 Antibody (1D1-1A9) - Azide and BSA Free | H00056949-M01
- RhoC Antibody (1B7) - Azide and BSA Free | H00000389-M06
questions and comments
