product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Centrin 3 Antibody (3E6) - Azide and BSA Free
catalog :
H00001070-M01-50ug
quantity :
50 ug
price :
529 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3.00E+06
reactivity :
human, mouse, chicken, zebrafish
application :
western blot, ELISA, immunocytochemistry, immunoprecipitation
more info or order :
citations: 47
Reference
Tsekitsidou E, Wong C, Ulengin Talkish I, Barth A, Stearns T, Gingras A, et al. Calcineurin associates with centrosomes and regulates cilia length maintenance. J Cell Sci. 2023;136: pubmed publisher
Ning K, Luo Z, Kowal T, Tran M, Majumder R, Jarin T, et al. Characterization of Primary Cilia Formation in Human ESC-Derived Retinal Organoids. Stem Cells Int. 2023;2023:6494486 pubmed publisher
L xf3 pez Jim xe9 nez P, P xe9 rez Mart xed n S, Hidalgo I, Garc xed a Gonzalo F, Page J, G xf3 mez R. The Male Mouse Meiotic Cilium Emanates from the Mother Centriole at Zygotene Prior to Centrosome Duplication. Cells. 2022;12: pubmed publisher
Laporte M, Bouhlel I, Bertiaux E, Morrison C, Giroud A, Borgers S, et al. Human SFI1 and Centrin form a complex critical for centriole architecture and ciliogenesis. EMBO J. 2022;41:e112107 pubmed publisher
Serra C, Liu H, Qian J, Mori M, LU J, Cardoso W. Prominin 1 and Notch regulate ciliary length and dynamics in multiciliated cells of the airway epithelium. iScience. 2022;25:104751 pubmed publisher
Berenguer I, L xf3 pez Jim xe9 nez P, Mena I, Viera A, Page J, Gonz xe1 lez Mart xed nez J, et al. Haspin participates in AURKB recruitment to centromeres and contributes to chromosome congression in male mouse meiosis. J Cell Sci. 2022;135: pubmed publisher
Tischer T, Yang J, Barford D. The APC/C targets the Cep152-Cep63 complex at the centrosome to regulate mitotic spindle assembly. J Cell Sci. 2022;135: pubmed publisher
Wang M, Rogers G, Cress A. Immunofluorescence-based Determination of Centrosome Number in Tissue Samples. Bio Protoc. 2019;9:e3396 pubmed publisher
Sala R, Farrell K, Stearns T. Growth disadvantage associated with centrosome amplification drives population-level centriole number homeostasis. Mol Biol Cell. 2020;31:2646-2656 pubmed publisher
Wigington C, Roy J, Damle N, Yadav V, Blikstad C, Resch E, et al. Systematic Discovery of Short Linear Motifs Decodes Calcineurin Phosphatase Signaling. Mol Cell. 2020;79:342-358.e12 pubmed publisher
Aydin O, Taflan S, Gurkaslar C, Firat Karalar E. Acute inhibition of centriolar satellite function and positioning reveals their functions at the primary cilium. PLoS Biol. 2020;18:e3000679 pubmed publisher
Gurkaslar H, Culfa E, Arslanhan M, Lince Faria M, Firat Karalar E. CCDC57 Cooperates with Microtubules and Microcephaly Protein CEP63 and Regulates Centriole Duplication and Mitotic Progression. Cell Rep. 2020;31:107630 pubmed publisher
Ochi T, Quarantotti V, Lin H, Jullien J, Rosa e Silva I, Boselli F, et al. CCDC61/VFL3 Is a Paralog of SAS6 and Promotes Ciliary Functions. Structure. 2020;28:674-689.e11 pubmed publisher
Wang T, Zou Y, Huang N, Teng J, Chen J. CCDC84 Acetylation Oscillation Regulates Centrosome Duplication by Modulating HsSAS-6 Degradation. Cell Rep. 2019;29:2078-2091.e5 pubmed publisher
Bassaganyas L, Popa S, Horlbeck M, Puri C, Stewart S, Campelo F, et al. New factors for protein transport identified by a genome-wide CRISPRi screen in mammalian cells. J Cell Biol. 2019;218:3861-3879 pubmed publisher
Wang M, Nagle R, Knudsen B, Cress A, Rogers G. Centrosome loss results in an unstable genome and malignant prostate tumors. Oncogene. 2019;: pubmed publisher
Mariappan A, Soni K, Schorpp K, Zhao F, Minakar A, Zheng X, et al. Inhibition of CPAP-tubulin interaction prevents proliferation of centrosome-amplified cancer cells. EMBO J. 2019;38: pubmed publisher
Jenks A, Vyse S, Wong J, Kostaras E, Keller D, Burgoyne T, et al. Primary Cilia Mediate Diverse Kinase Inhibitor Resistance Mechanisms in Cancer. Cell Rep. 2018;23:3042-3055 pubmed publisher
Krastev D, Pettitt S, Campbell J, Song F, Tanos B, Stoynov S, et al. Coupling bimolecular PARylation biosensors with genetic screens to identify PARylation targets. Nat Commun. 2018;9:2016 pubmed publisher
Breslow D, Hoogendoorn S, Kopp A, Morgens D, Vu B, Kennedy M, et al. A CRISPR-based screen for Hedgehog signaling provides insights into ciliary function and ciliopathies. Nat Genet. 2018;50:460-471 pubmed publisher
Ogungbenro Y, Tena T, Gaboriau D, Lalor P, Dockery P, Philipp M, et al. Centrobin controls primary ciliogenesis in vertebrates. J Cell Biol. 2018;217:1205-1215 pubmed publisher
Wang J, Kong D, Hoerner C, Loncarek J, Stearns T. Centriole triplet microtubules are required for stable centriole formation and inheritance in human cells. elife. 2017;6: pubmed publisher
Chen H, Wu C, Tang C, Lin Y, Wang W, Tang T. Human microcephaly protein RTTN interacts with STIL and is required to build full-length centrioles. Nat Commun. 2017;8:247 pubmed publisher
Pruikkonen S, Kallio M. Excess of a Rassf1-targeting microRNA, miR-193a-3p, perturbs cell division fidelity. Br J Cancer. 2017;116:1451-1461 pubmed publisher
Doobin D, Kemal S, Dantas T, Vallee R. Severe NDE1-mediated microcephaly results from neural progenitor cell cycle arrests at multiple specific stages. Nat Commun. 2016;7:12551 pubmed publisher
Tambe M, Narvi E, Kallio M. Reduced levels of Dusp3/Vhr phosphatase impair normal spindle bipolarity in an Erk1/2 activity-dependent manner. FEBS Lett. 2016;590:2757-67 pubmed publisher
Chang C, Hsu W, Tsai J, Tang C, Tang T. CEP295 interacts with microtubules and is required for centriole elongation. J Cell Sci. 2016;129:2501-13 pubmed publisher
Chavali P, Chandrasekaran G, Barr A, Tátrai P, Taylor C, Papachristou E, et al. A CEP215-HSET complex links centrosomes with spindle poles and drives centrosome clustering in cancer. Nat Commun. 2016;7:11005 pubmed publisher
Sawant D, Majumder S, Perkins J, Yang C, Eyers P, Fisk H. Centrin 3 is an inhibitor of centrosomal Mps1 and antagonizes centrin 2 function. Mol Biol Cell. 2015;26:3741-53 pubmed publisher
Antonczak A, Mullee L, Wang Y, Comartin D, Inoue T, Pelletier L, et al. Opposing effects of pericentrin and microcephalin on the pericentriolar material regulate CHK1 activation in the DNA damage response. Oncogene. 2016;35:2003-10 pubmed publisher
Martin C, Ahmad I, Klingseisen A, Hussain M, Bicknell L, Leitch A, et al. Mutations in PLK4, encoding a master regulator of centriole biogenesis, cause microcephaly, growth failure and retinopathy. Nat Genet. 2014;46:1283-1292 pubmed publisher
Kaczmarczyk A, Sullivan K. CENP-W plays a role in maintaining bipolar spindle structure. PLoS ONE. 2014;9:e106464 pubmed publisher
Lee Y, Santé J, Comerci C, Cyge B, Menezes L, Li F, et al. Cby1 promotes Ahi1 recruitment to a ring-shaped domain at the centriole-cilium interface and facilitates proper cilium formation and function. Mol Biol Cell. 2014;25:2919-33 pubmed publisher
Mäki Jouppila J, Laine L, Rehnberg J, Narvi E, Tiikkainen P, Hukasova E, et al. Centmitor-1, a novel acridinyl-acetohydrazide, possesses similar molecular interaction field and antimitotic cellular phenotype as rigosertib, on 01910.Na. Mol Cancer Ther. 2014;13:1054-66 pubmed publisher
Sir J, Putz M, Daly O, Morrison C, Dunning M, Kilmartin J, et al. Loss of centrioles causes chromosomal instability in vertebrate somatic cells. J Cell Biol. 2013;203:747-56 pubmed publisher
Inan B, P tz M, Lalor P, Dockery P, Kuriyama R, Gergely F, et al. Abnormal centrosomal structure and duplication in Cep135-deficient vertebrate cells. Mol Biol Cell. 2013;24:2645-54 pubmed publisher
Dantas T, Daly O, Conroy P, Tomas M, Wang Y, Lalor P, et al. Calcium-binding capacity of centrin2 is required for linear POC5 assembly but not for nucleotide excision repair. PLoS ONE. 2013;8:e68487 pubmed publisher
Patel K, Scrimieri F, Ghosh S, Zhong J, Kim M, Ren Y, et al. FAM190A deficiency creates a cell division defect. Am J Pathol. 2013;183:296-303 pubmed publisher
Wang W, Tay H, Soni R, Perumal G, Goll M, Macaluso F, et al. CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base. Nat Cell Biol. 2013;15:591-601 pubmed publisher
Schaub J, Stearns T. The Rilp-like proteins Rilpl1 and Rilpl2 regulate ciliary membrane content. Mol Biol Cell. 2013;24:453-64 pubmed publisher
McIntyre R, Lakshminarasimhan Chavali P, Ismail O, Carragher D, Sanchez Andrade G, Forment J, et al. Disruption of mouse Cenpj, a regulator of centriole biogenesis, phenocopies Seckel syndrome. PLoS Genet. 2012;8:e1003022 pubmed publisher
Conroy P, Saladino C, Dantas T, Lalor P, Dockery P, Morrison C. C-NAP1 and rootletin restrain DNA damage-induced centriole splitting and facilitate ciliogenesis. Cell Cycle. 2012;11:3769-78 pubmed publisher
Loffler H, Fechter A, Liu F, Poppelreuther S, Kramer A. DNA damage-induced centrosome amplification occurs via excessive formation of centriolar satellites. Oncogene. 2013;32:2963-72 pubmed publisher
Sir J, Barr A, Nicholas A, Carvalho O, Khurshid M, Sossick A, et al. A primary microcephaly protein complex forms a ring around parental centrioles. Nat Genet. 2011;43:1147-53 pubmed publisher
Dantas T, Wang Y, Lalor P, Dockery P, Morrison C. Defective nucleotide excision repair with normal centrosome structures and functions in the absence of all vertebrate centrins. J Cell Biol. 2011;193:307-18 pubmed publisher
Fabian Z, Fearnhead H. TPCK targets elements of mitotic spindle and induces cell cycle arrest in prometaphase. Biochem Biophys Res Commun. 2010;395:458-64 pubmed publisher
Barr A, Kilmartin J, Gergely F. CDK5RAP2 functions in centrosome to spindle pole attachment and DNA damage response. J Cell Biol. 2010;189:23-39 pubmed publisher
product information
master code :
H00001070-M01
SKU :
H00001070-M01-50ug
product name :
Centrin 3 Antibody (3E6) - Azide and BSA Free
unit size :
50 ug
description :
The Centrin 3 Antibody (3E6) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Centrin 3. This antibody reacts with chicken,human,mouse,rat,zebrafish,fish - danio rerio (zebrafish). The Centrin 3 Antibody (3E6) - Azide and BSA Free has been validated for the following applications: Immunocytochemistry/ Immunofluorescence,Immunoprecipitation,Western Blot,ELISA,Knockdown Validated.
target :
Centrin 3
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
3.00E+06
conjugate :
Unconjugated
host :
Mouse
immunogen :
MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDT
DKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREAT
GKITFEDFNEVVTDWILERDPH
CETN3 (AAH05383, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2b Kappa
purity :
IgG purified
species :
Chicken,Human,Mouse,Rat,Zebrafish,Fish - Danio rerio (Zebrafish)
specificity :
CETN3 - centrin, EF-hand protein, 3 (CDC31 homolog, yeast)
gene symbol :
CETN3
accessionNumbers :
AAH05383
applications :
Immunocytochemistry/ Immunofluorescence,Immunoprecipitation,Western Blot,ELISA,Knockdown Validated
USD :
529 USD
alt names :
CDC31 yeast homolog, CEN3centrin, EF-hand protein, 3 (CDC31 homolog, yeast), centrin, EF-hand protein, 3, centrin, EF-hand protein, 3 (CDC31 yeast homolog), centrin-3, EF-hand superfamily member, MGC12502, MGC138245
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.