product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Corneodesmosin Antibody (6F11) - Azide and BSA Free
catalog :
H00001041-M01
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
6F11
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
more info or order :
citations: 6
| Reference |
|---|
Fluhr J, Lachmann N, Baudouin C, Msika P, Darlenski R, de Belilovsky C, et al. Development and organization of human stratum corneum after birth: electron microscopy isotropy score and immunocytochemical corneocyte labelling as epidermal maturation's markers in infancy. Br J Dermatol. 2014;171:978-86 pubmed publisher
|
product information
master code :
H00001041-M01
SKU :
H00001041-M01
product name :
Corneodesmosin Antibody (6F11) - Azide and BSA Free
unit size :
0.1 mg
description :
The Corneodesmosin Antibody (6F11) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Corneodesmosin. This antibody reacts with human. The Corneodesmosin Antibody (6F11) - Azide and BSA Free has been validated for the following applications: ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence.
target :
Corneodesmosin
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
6F11
conjugate :
Unconjugated
host :
Mouse
immunogen :
YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPP
ISEGKYFSSNP
CDSN (NP_001255, 306 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
ISEGKYFSSNP
CDSN (NP_001255, 306 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human
specificity :
CDSN - corneodesmosin
gene symbol :
CDSN
accessionNumbers :
NP_001255
applications :
ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
corneodesmosin, D6S586E, differentiated keratinocyte S protein, HTSS, S, S protein
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
