RUNX2/CBFA1 Antibody (3F5) - Azide and BSA Free | Novus Biologicals H00000860-M06 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

RUNX2/CBFA1 Antibody (3F5) - Azide and BSA Free

catalog :

H00000860-M06

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3F5

reactivity :

human, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, chromatin immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
CARR F, Tai P, Barnum M, Gillis N, Evans K, Taber T, et al. Thyroid Hormone Receptor-? (TR?) Mediates Runt-Related Transcription Factor 2 (Runx2) Expression in Thyroid Cancer Cells: A Novel Signaling Pathway in Thyroid Cancer. Endocrinology. 2016;157:3278-92 pubmed publisher
Bleil J, Maier R, Hempfing A, Sieper J, Appel H, Syrbe U. Granulation Tissue Eroding the Subchondral Bone Also Promotes New Bone Formation in Ankylosing Spondylitis. Arthritis Rheumatol. 2016;68:2456-65 pubmed publisher
Gruber H, Ode G, Hoelscher G, Ingram J, Bethea S, Bosse M. Osteogenic, stem cell and molecular characterisation of the human induced membrane from extremity bone defects. Bone Joint Res. 2016;5:106-15 pubmed publisher
Sonomoto K, Yamaoka K, Kaneko H, Yamagata K, Sakata K, Zhang X, et al. Spontaneous Differentiation of Human Mesenchymal Stem Cells on Poly-Lactic-Co-Glycolic Acid Nano-Fiber Scaffold. PLoS ONE. 2016;11:e0153231 pubmed publisher
Niu D, Kondo T, Nakazawa T, Oishi N, Kawasaki T, Mochizuki K, et al. Transcription factor Runx2 is a regulator of epithelial-mesenchymal transition and invasion in thyroid carcinomas. Lab Invest. 2012;92:1181-90 pubmed publisher
Li X, Zhou L, Takai H, Sasaki Y, Mezawa M, Li Z, et al. Aggregatibacter actinomycetemcomitans lipopolysaccharide regulates bone sialoprotein gene transcription. J Cell Biochem. 2012;113:2822-34 pubmed publisher
Li Z, Sasaki Y, Mezawa M, Wang S, Li X, Yang L, et al. cAMP and fibroblast growth factor 2 regulate bone sialoprotein gene expression in human prostate cancer cells. Gene. 2011;471:1-12 pubmed publisher
Wang Z, Li X, Li Z, Yang L, Sasaki Y, Wang S, et al. Effects of inorganic polyphosphate on bone sialoprotein gene expression. Gene. 2010;452:79-86 pubmed publisher

product information

master code :

H00000860-M06

SKU :

H00000860-M06

product name :

RUNX2/CBFA1 Antibody (3F5) - Azide and BSA Free

unit size :

0.1 mg

description :

The RUNX2/CBFA1 Antibody (3F5) - Azide and BSA Free from Novus is a mouse monoclonal antibody to RUNX2/CBFA1. This antibody reacts with human,rat. The RUNX2/CBFA1 Antibody (3F5) - Azide and BSA Free has been validated for the following applications: IF/IHC,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Functional,Chromatin Immunoprecipitation (ChIP),Immunocytochemistry/ Immunofluorescence.

target :

RUNX2/CBFA1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3F5

conjugate :

Unconjugated

host :

Mouse

immunogen :

NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSY
PSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDD
DTATSDFCLWPSTLSKKSQAGA
RUNX2 (NP_004339, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Rat

theoretical molecular weight :

56.6 kDa

gene symbol :

RUNX2

accessionNumbers :

NP_004339

applications :

IF/IHC,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Functional,Chromatin Immunoprecipitation (ChIP),Immunocytochemistry/ Immunofluorescence

USD :

499 USD

alt names :

Acute myeloid leukemia 3 protein, CBFA1, CBF-alpha-1, CCD1, CCDAML3, CLCD, Core-binding factor subunit alpha-1, core-binding factor, runt domain, alpha subunit 1, MGC120023, ML3, oncogene AML-3, OSF2, OSF-2, osteoblast-specific transcription factor 2, PEA2aA, PEA2-alpha A, PEBP2A, PEBP2aA, PEBP2-alpha A, polyomavirus enhancer-binding protein 2 alpha A subunit, runt domain, alpha subunit 1, runt related transcription factor 2, runt-related transcription factor 2, RUNX2, SL3/AKV core-binding factor alpha A subunit, SL3-3 enhancer factor 1 alpha A subunit

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage