RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free | Novus Biologicals H00000860-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free

catalog :

H00000860-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1D8

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Yin H, Liu W, Huang Y, Ren Y, Xu L, Xu J, et al. Surface Epitaxial Crystallization-Directed Nanotopography for Accelerating Preosteoblast Proliferation and Osteogenic Differentiation. ACS Appl Mater Interfaces. 2019;11:42956-42963 pubmed publisher
Scimeca M, Urbano N, Bonfiglio R, Schillaci O, Bonanno E. Breast osteoblast-like cells: a new biomarker for the management of breast cancer. Br J Cancer. 2018;119:1129-1132 pubmed publisher
Posa F, Di Benedetto A, Cavalcanti Adam E, Colaianni G, Porro C, Trotta T, et al. Vitamin D Promotes MSC Osteogenic Differentiation Stimulating Cell Adhesion and αVβ3 Expression. Stem Cells Int. 2018;2018:6958713 pubmed publisher
D Alessandro D, Pertici G, Moscato S, Metelli M, Danti S, Nesti C, et al. Processing large-diameter poly(L-lactic acid) microfiber mesh/mesenchymal stromal cell constructs via resin embedding: an efficient histologic method. Biomed Mater. 2014;9:045007 pubmed publisher
Sase T, Suzuki T, Miura K, Shiiba K, Sato I, Nakamura Y, et al. Runt-related transcription factor 2 in human colon carcinoma: a potent prognostic factor associated with estrogen receptor. Int J Cancer. 2012;131:2284-93 pubmed publisher
Yang X, Fullerton D, Su X, Ao L, Cleveland J, Meng X. Pro-osteogenic phenotype of human aortic valve interstitial cells is associated with higher levels of Toll-like receptors 2 and 4 and enhanced expression of bone morphogenetic protein 2. J Am Coll Cardiol. 2009;53:491-500 pubmed publisher

product information

master code :

H00000860-M01

SKU :

H00000860-M01

product name :

RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free

unit size :

0.1 mg

description :

The RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free from Novus is a mouse monoclonal antibody to RUNX2/CBFA1. This antibody reacts with human,mouse,rat. The RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free has been validated for the following applications: Immunohistochemistry-Paraffin,ELISA,Immunohistochemistry,Western Blot,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence.

target :

RUNX2/CBFA1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

1D8

conjugate :

Unconjugated

host :

Mouse

immunogen :

NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSY
PSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDD
DTATSDFCLWPSTLSKKSQAGA
RUNX2/CBFA1 (NP_004339, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2b

purity :

IgG purified

species :

Human,Mouse,Rat

theoretical molecular weight :

56.6 kDa

gene symbol :

RUNX2

accessionNumbers :

NP_004339

applications :

Immunohistochemistry-Paraffin,ELISA,Immunohistochemistry,Western Blot,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

Acute myeloid leukemia 3 protein, CBFA1, CBF-alpha-1, CCD1, CCDAML3, CLCD, Core-binding factor subunit alpha-1, core-binding factor, runt domain, alpha subunit 1, MGC120023, ML3, oncogene AML-3, OSF2, OSF-2, osteoblast-specific transcription factor 2, PEA2aA, PEA2-alpha A, PEBP2A, PEBP2aA, PEBP2-alpha A, polyomavirus enhancer-binding protein 2 alpha A subunit, runt domain, alpha subunit 1, runt related transcription factor 2, runt-related transcription factor 2, RUNX2, SL3/AKV core-binding factor alpha A subunit, SL3-3 enhancer factor 1 alpha A subunit

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage