product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ATOX1 Antibody (2E6) - Azide and BSA Free
catalog :
H00000475-M01
quantity :
0.1 mg
price :
529 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2.00E+06
reactivity :
human
application :
western blot, ELISA, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 3
| Reference |
|---|
product information
master code :
H00000475-M01
SKU :
H00000475-M01
product name :
ATOX1 Antibody (2E6) - Azide and BSA Free
unit size :
0.1 mg
description :
The ATOX1 Antibody (2E6) - Azide and BSA Free from Novus is a mouse monoclonal antibody to ATOX1. This antibody reacts with human. The ATOX1 Antibody (2E6) - Azide and BSA Free has been validated for the following applications: Immunohistochemistry-Paraffin,ELISA,Western Blot,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence.
target :
ATOX1
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
2.00E+06
conjugate :
Unconjugated
host :
Mouse
immunogen :
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKK
VCIESEHSMDTLLATLKKTGKTVSYLGLE
ATOX1 (NP_004036, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
VCIESEHSMDTLLATLKKTGKTVSYLGLE
ATOX1 (NP_004036, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human
specificity :
ATOX1 - ATX1 antioxidant protein 1 homolog (yeast)
gene symbol :
ATOX1
accessionNumbers :
NP_004036
applications :
Immunohistochemistry-Paraffin,ELISA,Western Blot,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
ATX1, ATX1 (antioxidant protein 1, yeast) homolog 1, ATX1 antioxidant protein 1 homolog (yeast), copper transport protein ATOX1, hah1, HAH1 MGC138453, Metal transport protein ATX1, MGC138455
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
