ATF4 Antibody (2B3) - Azide and BSA Free | Novus Biologicals H00000468-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

ATF4 Antibody (2B3) - Azide and BSA Free

catalog :

H00000468-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2B3

reactivity :

human, mouse

application :

western blot, ELISA, immunocytochemistry

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Zhou B, Lu Q, Liu J, Fan L, Wang Y, Wei W, et al. Melatonin Increases the Sensitivity of Hepatocellular Carcinoma to Sorafenib through the PERK-ATF4-Beclin1 Pathway. Int J Biol Sci. 2019;15:1905-1920 pubmed publisher
Di Benedetto A, Posa F, De Maria S, Ravagnan G, Ballini A, Porro C, et al. Polydatin, Natural Precursor of Resveratrol, Promotes Osteogenic Differentiation of Mesenchymal Stem Cells. Int J Med Sci. 2018;15:944-952 pubmed publisher
Wang L, Wang X, Zhang S, Qu G, Liu S. A protective role of heme-regulated eIF2? kinase in cadmium-induced toxicity in erythroid cells. Food Chem Toxicol. 2013;62:880-91 pubmed publisher
Ghemrawi R, Pooya S, Lorentz S, Gauchotte G, Arnold C, Gueant J, et al. Decreased vitamin B12 availability induces ER stress through impaired SIRT1-deacetylation of HSF1. Cell Death Dis. 2013;4:e553 pubmed publisher
Wang X, Guo B, Li Q, Peng J, Yang Z, Wang A, et al. miR-214 targets ATF4 to inhibit bone formation. Nat Med. 2013;19:93-100 pubmed publisher
Suragani R, Zachariah R, Velazquez J, Liu S, Sun C, Townes T, et al. Heme-regulated eIF2? kinase activated Atf4 signaling pathway in oxidative stress and erythropoiesis. Blood. 2012;119:5276-84 pubmed publisher
Cole B, Kuhn N, Green Mitchell S, Leone K, Raab R, Nadler J, et al. 12/15-Lipoxygenase signaling in the endoplasmic reticulum stress response. Am J Physiol Endocrinol Metab. 2012;302:E654-65 pubmed publisher
Meister S, Frey B, Lang V, Gaipl U, Schett G, Schlötzer Schrehardt U, et al. Calcium channel blocker verapamil enhances endoplasmic reticulum stress and cell death induced by proteasome inhibition in myeloma cells. Neoplasia. 2010;12:550-61 pubmed

product information

master code :

H00000468-M01

SKU :

H00000468-M01

product name :

ATF4 Antibody (2B3) - Azide and BSA Free

unit size :

0.1 mg

description :

The ATF4 Antibody (2B3) - Azide and BSA Free from Novus is a mouse monoclonal antibody to ATF4. This antibody reacts with human,mouse. The ATF4 Antibody (2B3) - Azide and BSA Free has been validated for the following applications: Western Blot,ELISA,Immunocytochemistry/ Immunofluorescence.

target :

ATF4

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

2B3

conjugate :

Unconjugated

host :

Mouse

immunogen :

SSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIK
EEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPS
PGVLCGSARPKPYDPPGEKMVA
ATF4 (NP_001666.2, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human,Mouse

specificity :

ATF4 - activating transcription factor 4 (tax-responsive enhancer element B67)

gene symbol :

ATF4

accessionNumbers :

P18848

applications :

Western Blot,ELISA,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

Activating transcription factor 4, activating transcription factor 4 (tax-responsive enhancer element B67), cAMP-dependent transcription factor ATF-4, cAMP-responsive element-binding protein 2, CREB-2DNA-binding protein TAXREB67, cyclic AMP-dependent transcription factor ATF-4, Cyclic AMP-responsive element-binding protein 2, TaxREB67, TAXREB67CREB2cAMP response element-binding protein 2, Tax-responsive enhancer element-binding protein 67, TXREB

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage