product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
RhoA Antibody (1B12) - Azide and BSA Free
catalog :
H00000387-M04
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1B12
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 3
| Reference |
|---|
Ma L, Liu Y, Zhang X, Geng C, Li Z. Relationship of RhoA signaling activity with ezrin expression and its significance in the prognosis for breast cancer patients. Chin Med J (Engl). 2013;126:242-7 pubmed
|
product information
master code :
H00000387-M04
SKU :
H00000387-M04
product name :
RhoA Antibody (1B12) - Azide and BSA Free
unit size :
0.1 mg
description :
The RhoA Antibody (1B12) - Azide and BSA Free from Novus is a mouse monoclonal antibody to RhoA. This antibody reacts with human. The RhoA Antibody (1B12) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
RhoA
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
1B12
conjugate :
Unconjugated
host :
Mouse
immunogen :
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVF
ENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTD
VILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGN
KKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGY
MECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
RHOA (AAH01360, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
ENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTD
VILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGN
KKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGY
MECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
RHOA (AAH01360, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG1 Lambda
purity :
IgG purified
species :
Human
specificity :
RHOA - ras homolog gene family, member A
gene symbol :
RHOA
accessionNumbers :
AAH01360
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
h12, oncogene RHO H12, ras homolog gene family, member A, Rho cDNA clone 12, Rho12, RhoA, RHOH12ARH12ARHAAplysia ras-related homolog 12, small GTP binding protein RhoA, transforming protein RhoA
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
