product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ARF5 Antibody (1B4) - Azide and BSA Free
catalog :
H00000381-M01
quantity :
0.1 mg
price :
529 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1B4
reactivity :
human, mouse, rat, dogs
application :
western blot, ELISA, immunocytochemistry
more info or order :
Novus Biologicals product webpage
citations: 14
Reference
Fayad R, Rojas M, Partisani M, Finetti P, Dib S, Abélanet S, et al. EFA6B regulates a stop signal for collective invasion in breast cancer. Nat Commun. 2021;12:2198 pubmed publisher
Nacke M, Sandilands E, Nikolatou K, Román Fernández Á, Mason S, Patel R, et al. An ARF GTPase module promoting invasion and metastasis through regulating phosphoinositide metabolism. Nat Commun. 2021;12:1623 pubmed publisher
Liu L, Zhang S, Wang Y, Bao W, Zhou Y, Dang W, et al. BIG1 controls macrophage pro-inflammatory responses through ARF3-mediated PI(4,5)P2 synthesis. Cell Death Dis. 2020;11:374 pubmed publisher
Ignashkova T, Gendarme M, Peschk K, Eggenweiler H, Lindemann R, Reiling J. Cell survival and protein secretion associated with Golgi integrity in response to Golgi stress-inducing agents. Traffic. 2017;18:530-544 pubmed publisher
Wesolowski J, Weber M, Nawrotek A, Dooley C, Calderon M, St Croix C, et al. Chlamydia Hijacks ARF GTPases To Coordinate Microtubule Posttranslational Modifications and Golgi Complex Positioning. MBio. 2017;8: pubmed publisher
Hanai A, Ohgi M, Yagi C, Ueda T, Shin H, Nakayama K. Class I Arfs (Arf1 and Arf3) and Arf6 are localized to the Flemming body and play important roles in cytokinesis. J Biochem. 2016;159:201-8 pubmed publisher
Münzberg C, Höhn K, Krndija D, Maaß U, Bartsch D, Slater E, et al. IGF-1 drives chromogranin A secretion via activation of Arf1 in human neuroendocrine tumour cells. J Cell Mol Med. 2015;19:948-59 pubmed publisher
Reiling J, Olive A, Sanyal S, Carette J, Brummelkamp T, Ploegh H, et al. A CREB3-ARF4 signalling pathway mediates the response to Golgi stress and susceptibility to pathogens. Nat Cell Biol. 2013;15:1473-85 pubmed publisher
Nakai W, Kondo Y, Saitoh A, Naito T, Nakayama K, Shin H. ARF1 and ARF4 regulate recycling endosomal morphology and retrograde transport from endosomes to the Golgi apparatus. Mol Biol Cell. 2013;24:2570-81 pubmed publisher
Takashima K, Saitoh A, Hirose S, Nakai W, Kondo Y, Takasu Y, et al. GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis. Cell Struct Funct. 2011;36:223-35 pubmed
Kudelko M, Brault J, Kwok K, Li M, Pardigon N, Peiris J, et al. Class II ADP-ribosylation factors are required for efficient secretion of dengue viruses. J Biol Chem. 2012;287:767-77 pubmed publisher
Puxeddu E, Uhart M, Li C, Ahmad F, Pacheco Rodriguez G, Manganiello V, et al. Interaction of phosphodiesterase 3A with brefeldin A-inhibited guanine nucleotide-exchange proteins BIG1 and BIG2 and effect on ARF1 activity. Proc Natl Acad Sci U S A. 2009;106:6158-63 pubmed publisher
Klein S, Partisani M, Franco M, Luton F. EFA6 facilitates the assembly of the tight junction by coordinating an Arf6-dependent and -independent pathway. J Biol Chem. 2008;283:30129-38 pubmed publisher
Islam A, Shen X, Hiroi T, Moss J, Vaughan M, Levine S. The brefeldin A-inhibited guanine nucleotide-exchange protein, BIG2, regulates the constitutive release of TNFR1 exosome-like vesicles. J Biol Chem. 2007;282:9591-9 pubmed
product information
master code :
H00000381-M01
SKU :
H00000381-M01
product name :
ARF5 Antibody (1B4) - Azide and BSA Free
unit size :
0.1 mg
description :
The ARF5 Antibody (1B4) - Azide and BSA Free from Novus is a mouse monoclonal antibody to ARF5. This antibody reacts with bacteria,canine,human,mouse,rat. The ARF5 Antibody (1B4) - Azide and BSA Free has been validated for the following applications: Western Blot,ELISA,Immunocytochemistry/ Immunofluorescence.
target :
ARF5
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
1B4
conjugate :
Unconjugated
host :
Mouse
immunogen :
YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDA
VLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQAT
CATQGTGLYDGLDWLSHELSKR
ARF5 (AAH03043, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG1 Kappa
purity :
IgG purified
species :
Bacteria,Canine,Human,Mouse,Rat
specificity :
ARF5 - ADP-ribosylation factor 5
gene symbol :
ARF5
accessionNumbers :
AAH03043
applications :
Western Blot,ELISA,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
ADP-ribosylation factor 5
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
Novus Biologicals product webpage
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.