product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Annexin A2 Antibody (1G7) - Azide and BSA Free
catalog :
H00000302-M02
quantity :
0.1 mg
price :
529 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1G7
reactivity :
human, mouse
application :
western blot, ELISA, immunocytochemistry, immunoprecipitation, flow cytometry
more info or order :
citations: 7
Reference
Tramutola A, Abate G, Lanzillotta C, Triani F, Barone E, Iavarone F, et al. Protein nitration profile of CD3+ lymphocytes from Alzheimer disease patients: Novel hints on immunosenescence and biomarker detection. Free Radic Biol Med. 2018;129:430-439 pubmed publisher
Wang Y, Chen K, Cai Y, Cai Y, Yuan X, Wang L, et al. Annexin A2 could enhance multidrug resistance by regulating NF-?B signaling pathway in pediatric neuroblastoma. J Exp Clin Cancer Res. 2017;36:111 pubmed publisher
Na Pombejra S, Salemi M, Phinney B, Gelli A. The Metalloprotease, Mpr1, Engages AnnexinA2 to Promote the Transcytosis of Fungal Cells across the Blood-Brain Barrier. Front Cell Infect Microbiol. 2017;7:296 pubmed publisher
Staquicini D, Rangel R, Guzman Rojas L, Staquicini F, Dobroff A, Tarleton C, et al. Intracellular targeting of annexin A2 inhibits tumor cell adhesion, migration, and in vivo grafting. Sci Rep. 2017;7:4243 pubmed publisher
Zakrzewicz D, Didiasova M, Zakrzewicz A, Hocke A, Uhle F, Markart P, et al. The interaction of enolase-1 with caveolae-associated proteins regulates its subcellular localization. Biochem J. 2014;460:295-307 pubmed publisher
Deng F, Lei S, Zhang Y, Zhang Y, Zheng Y, Zhang L, et al. Peripheral blood monocyte-expressed ANXA2 gene is involved in pathogenesis of osteoporosis in humans. Mol Cell Proteomics. 2011;10:M111.011700 pubmed publisher
Menegay M, Lee D, Tabbara K, Cafaro T, Urrets Zavalia J, Serra H, et al. Proteomic analysis of climatic keratopathy droplets. Invest Ophthalmol Vis Sci. 2008;49:2829-37 pubmed publisher
product information
master code :
H00000302-M02
SKU :
H00000302-M02
product name :
Annexin A2 Antibody (1G7) - Azide and BSA Free
unit size :
0.1 mg
description :
The Annexin A2 Antibody (1G7) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Annexin A2. This antibody reacts with human,mouse. The Annexin A2 Antibody (1G7) - Azide and BSA Free has been validated for the following applications: Immunocytochemistry/ Immunofluorescence,Flow Cytometry,ELISA,Immunoprecipitation,Western Blot.
target :
Annexin A2
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
1G7
conjugate :
Unconjugated
host :
Mouse
immunogen :
MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDA
LNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRR
TKKELASALKSALSGHLETVILGLLKTPAQYDASELKAS
MKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLE
KDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDA
RDLYDAGVKRKGTDVPKWISVMTERSVPHLQKVFDRYKS
YSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADR
LYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYG
KSLYYYIQQDTKGDYQKALLYLCGGDD
ANXA2 (AAH66955, 19 a.a. ~ 357 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG1 Kappa
purity :
IgG purified
species :
Human,Mouse
specificity :
ANXA2 - annexin A2
gene symbol :
ANXA2
accessionNumbers :
AAH66955
applications :
Immunocytochemistry/ Immunofluorescence,Flow Cytometry,ELISA,Immunoprecipitation,Western Blot
USD :
529 USD
alt names :
annexin A2, Annexin II, annexin-2, ANX2, ANX2L4LPC2, CAL1H, Calpactin I heavy chain, calpactin I heavy polypeptide, Calpactin-1 heavy chain, chromobindin 8, Chromobindin-8, LIP2PAP-IV, Lipocortin II, LPC2DP36, p36, Placental anticoagulant protein IV, Protein I
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.