product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ALDH9A1 Antibody (3C6) - Azide and BSA Free
catalog :
H00000223-M01
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3C6
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
more info or order :
product information
master code :
H00000223-M01
SKU :
H00000223-M01
product name :
ALDH9A1 Antibody (3C6) - Azide and BSA Free
unit size :
0.1 mg
description :
The ALDH9A1 Antibody (3C6) - Azide and BSA Free from Novus is a mouse monoclonal antibody to ALDH9A1. This antibody reacts with human. The ALDH9A1 Antibody (3C6) - Azide and BSA Free has been validated for the following applications: ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence.
target :
ALDH9A1
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
3C6
conjugate :
Unconjugated
host :
Mouse
immunogen :
CGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQG
GAATGQFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKP
VTLELGGKSPLIIFSDCDMN
ALDH9A1 (NP_000687, 173 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
GAATGQFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKP
VTLELGGKSPLIIFSDCDMN
ALDH9A1 (NP_000687, 173 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG1 Kappa
purity :
IgG purified
species :
Human
specificity :
ALDH9A1 - aldehyde dehydrogenase 9 family, member A1 (3C6)
gene symbol :
ALDH9A1
accessionNumbers :
NP_000687
applications :
ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
aldehyde dehydrogenase 9 family, member A1, Aldehyde dehydrogenase E3 isozyme, Aldehyde dehydrogenase family 9 member A1, ALDH4, ALDH7, ALDH9aldehyde dehydrogenase (NAD+), E34-trimethylaminobutyraldehyde dehydrogenase, EC 1.2.1, EC 1.2.1.19, EC 1.2.1.3, EC 1.2.1.47, EC 1.2.1.8, Gamma-aminobutyraldehyde dehydrogenase, R-aminobutyraldehyde dehydrogenase, TMABADH
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
- Pyruvate Dehydrogenase E1 beta subunit Antibody (2B2) - Azide and BSA Free
- PTGIR Antibody (4B10) - Azide and BSA Free | H00005739-M01
- RPS5 Antibody (3G3) - Azide and BSA Free | H00006193-M01
- Epithelial Stromal Interaction 1 Antibody (2A8) - Azide and BSA Free | H00094240-M01
- Uromodulin Antibody (3F10) - Azide and BSA Free | H00007369-M03
questions and comments
