product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ALAS2 Antibody (6C1) - Azide and BSA Free
catalog :
H00000212-M01
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
6C1
reactivity :
human, mouse
application :
western blot, ELISA
more info or order :
citations: 4
| Reference |
|---|
product information
master code :
H00000212-M01
SKU :
H00000212-M01
product name :
ALAS2 Antibody (6C1) - Azide and BSA Free
unit size :
0.1 mg
description :
The ALAS2 Antibody (6C1) - Azide and BSA Free from Novus is a mouse monoclonal antibody to ALAS2. This antibody reacts with human,mouse. The ALAS2 Antibody (6C1) - Azide and BSA Free has been validated for the following applications: Western Blot,ELISA.
target :
ALAS2
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
6C1
conjugate :
Unconjugated
host :
Mouse
immunogen :
MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCP
ILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQ
DGKSKIVQKAAPEVQEDVKAFK
ALAS2 (NP_000023, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
ILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQ
DGKSKIVQKAAPEVQEDVKAFK
ALAS2 (NP_000023, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human,Mouse
specificity :
ALAS2 - aminolevulinate, delta-, synthase 2 (sideroblastic/hypochromic anemia)
gene symbol :
ALAS2
accessionNumbers :
NP_000023
applications :
Western Blot,ELISA
USD :
499 USD
alt names :
5-aminolevulinic acid synthase 2,5-aminolevulinate synthase, erythroid-specific, mitochondrial, ALASE, ALAS-E, aminolevulinate, delta-, synthase 2, aminolevulinate, delta-, synthase 2 (sideroblastic/hypochromic anemia), ANH1, ASBXLDPP, Delta-ALA synthase 2, delta-ALA synthetase, Delta-aminolevulinate synthase 2, EC 2.3.1.37, FLJ93603, XLSA
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
browse more products
questions and comments
