alpha-Fetoprotein/AFP Antibody (1G7) - Azide and BSA Free | Novus Biologicals H00000174-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

alpha-Fetoprotein/AFP Antibody (1G7) - Azide and BSA Free

catalog :

H00000174-M01

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1G7

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 9

Reference
Li C, Dong X, Lin Y, Sun X, Cai L, Yang X, et al. Establishing a human embryonic stem cell line (SKLRMe005-A) from a blastocyst with congenital heart disease (CHD). Stem Cell Res. 2023;68:103049 pubmed publisher
Li C, Cai L, Dong J, Ning S, Zhou J, Wu H, et al. Establishment of human embryonic stem cell (SKLRMe001-A)carrying Azoospermic factor c (AZFc) deletions. Stem Cell Res. 2022;59:102625 pubmed publisher
Li Y, Wu S, Yu Y, Zhang H, Wei R, Lv J, et al. Derivation of porcine extraembryonic endoderm-like cells from blastocysts. Cell Prolif. 2020;53:e12782 pubmed publisher
Tsai H, Wu H, Chou B, Li C, Gau B, Lin Z, et al. A magneto-microfluidic platform for fluorescence immunosensing using quantum dot nanoparticles. Nanotechnology. 2019;30:505101 pubmed publisher
Bikkuzin T, Shi Y, Sun B, Guo Y, Jin X, Han Z, et al. Human induced pluripotent stem cell line HMUi001-A derived from corneal stromal cells. Stem Cell Res. 2019;37:101409 pubmed publisher
Tsai H, Li S, Fuh C. Magnetofluorescent nanocomposites and quantum dots used for optimal application in magnetic fluorescence-linked immunoassay. Anal Bioanal Chem. 2018;410:1923-1929 pubmed publisher
Tsai H, Lin W, Chuang M, Lu Y, Fuh C. Multifunctional nanoparticles for protein detections in thin channels. Biosens Bioelectron. 2017;90:153-158 pubmed publisher
Funano S, Sugahara M, Henares T, Sueyoshi K, Endo T, Hisamoto H. A single-step enzyme immunoassay capillary sensor composed of functional multilayer coatings for the diagnosis of marker proteins. Analyst. 2015;140:1459-65 pubmed publisher
Ramón Azcón J, Yasukawa T, Mizutani F. Immunodevice for simultaneous detection of two relevant tumor markers based on separation of different microparticles by dielectrophoresis. Biosens Bioelectron. 2011;28:443-9 pubmed publisher

product information

master code :

H00000174-M01

SKU :

H00000174-M01

product name :

alpha-Fetoprotein/AFP Antibody (1G7) - Azide and BSA Free

unit size :

0.1 mg

description :

The alpha-Fetoprotein/AFP Antibody (1G7) - Azide and BSA Free from Novus is a mouse monoclonal antibody to alpha-Fetoprotein/AFP. This antibody reacts with human,porcine. The alpha-Fetoprotein/AFP Antibody (1G7) - Azide and BSA Free has been validated for the following applications: Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Functional.

target :

alpha-Fetoprotein/AFP

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

1G7

conjugate :

Unconjugated

host :

Mouse

immunogen :

CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLC
QAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSG
LLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
AFP (AAH27881, 500 a.a. ~ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Porcine

specificity :

AFP - alpha-fetoprotein

gene symbol :

AFP

accessionNumbers :

AAH27881

applications :

Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Functional

USD :

499 USD

alt names :

Alpha-1-fetoprotein, Alpha-fetoglobulin, alpha-fetoprotein, FETA, HP, HPAFP

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage