catalog number :
MBS969701
products type :
Recombinant Protein
products full name :
Recombinant Porphyromonas gingivalis Lys-gingipain (kgp), partial
products short name :
[Lys-gingipain]
products name syn :
[Lysine-specific cysteine proteinase Kgp]
other names :
[lysine-specific cysteine proteinase Kgp; Lys-gingipain; lysine-specific cysteine proteinase Kgp; Lysine-specific cysteine proteinase Kgp]
products gene name :
[kgp]
products gene name syn :
[kgp; PGN_1728]
other gene names :
[kgp; kgp]
uniprot entry name :
KGP_PORG3
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[229-594aa. Partial]
sequence :
DVYTDHGDLYNTPVRMLVVAGAKFKEALKPWLTWKAQKG
FYLDVHYTDEAEVGTTNASIKAFIHKKYNDGLAASAAPV
FLALVGDTDVISGEKGKKTKKVTDLYYSAVDGDYFPEMY
TFRMSASSPEELTNIIDKVLMYEKATMPDKSYLEKALLI
AGADSYWNPKIGQQTIKYAVQYYYNQDHGYTDVYSYPKA
PYTGCYSHLNTGVGFANYTAHGSETSWADPSLTATQVKA
LTNKDKYFLAIGNCCVTAQFDYPQPCFGEVMTRVKEKGA
YAYIGSSPNSYWGEDYYWSVGANAVFGVQPTFEGTSMGS
YDATFLEDSYNTVNSIMWAGNLAATHAGNIGNITHIGAH
YYWEAYHVLGDGSVM
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-Page
other info2 :
Species: Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257). Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Cysteine proteinase with a strong preference for substrates with Lys in the P1 position. Hydrolyzes bovine hemoglobin, bovine serum albumin, casein, human placental type I collagen and human IgA and IgG. Disrupts the functions of polymorphonuclear leukocytes. May act as a virulence factor in the development of peridontal disease. Involved in the coaggregation of P. gingivalis with other oral bacteria.
products references :
Biochemical and functional properties of lysine-specific cysteine proteinase (Lys-gingipain) as a virulence factor of Porphyromonas gingivalis in periodontal disease." Abe N., Kadowaki T., Okamoto K., Nakayama K., Ohishi M., Yamamoto K. J. Biochem. 123:305-312(1998)
ncbi acc num :
YP_001929844.1
ncbi gb acc num :
NC_010729.1
ncbi mol weight :
187,262 Da
uniprot summary :
Cysteine proteinase with a strong preference for substrates with Lys in the P1 position. Hydrolyzes bovine hemoglobin, bovine serum albumin, casein, human placental type I collagen and human IgA and IgG. Disrupts the functions of polymorphonuclear leukocytes. May act as a virulence factor in the development of peridontal disease. Involved in the coaggregation of P.gingivalis with other oral bacteria.
size6 :
0.05 mg (Baculovirus)
size9 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)