catalog number :
MBS969681
products type :
Recombinant Protein
products full name :
Recombinant Porphyromonas gingivalis Gingipain R1 (rgpA), partial
products short name :
[Porphyromonas gingivalis Gingipain R1 (rgpA)]
products name syn :
[Porphyromonas gingivalis]
other names :
[Gingipain R1; Gingipain R1; Arg-gingipain; Gingipain 1; RGP-1]
products gene name :
[rgpA]
other gene names :
[rgpA; rgp1]
uniprot entry name :
CPG1_PORGN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[228-720. partial]
sequence :
YTPVEEKQNGRMIVIVAKKYEGDIKDFVDWKNQRGLRTE
VKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGD
HKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCES
KEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPS
ADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNI
IDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSN
QLPFIFDVACVNGDFLFSMPCFAEALMRAQKDGKPTGTV
AIIASTINQSWASPMRGQDEMNEILCEKHPNNIKRTFGG
VTMNGMFAMVEKYKKDGEKMLDTWTVFGDPSLLVRTLVP
TKMQVTAPAQINLTDASVNVSCDYNGAIATISANGKMFG
SAVVENGTATINLTGLTNESTLTLTVVGYNKETVIKTIN
TNGEPNPYQPVSNLTATTQGQKVTLKWDAPSTKTNATTN
TARSVDGIRELVLLSVSDAPELLRS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-Page
other info2 :
Species: Porphyromonas gingivalis. Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Thrombin-like snake venom serine protease that acts as an anticoagulant. It cleaves fibrinogen (FGA) to split off the A-fibrinopeptides (A, AY and AP), but not the B-fibrinopeptide. The resulting fibrin polymers are imperfectly formed and much smaller in size (1 to 2 um long) than the fibrin polymers produced by the action of thrombin. These ancrod-induced microthrombi are friable, unstable, urea-soluble and have significantly degraded alpha chains. They do not cross-link to form thrombi. They are markedly susceptible to digestion by plasmin and are rapidly roved from circulation by either reticuloendothelial phagocytosis or normal fibrinolysis, or both. Anticoagulation through the roval of fibrinogen from the blood is rapid, occurring within hours following its administration. It does not activate plasminogen and does not degrade preformed, fully cross-linked thrombin fibrin. It also reduces the level of plasminogen activator inhibitor (PAI) and may stimulate the release of tissue plasminogen activator (PLAT) from the endothelium. The profibrinolytic effect of these 2 actions appears to be limited to local microthrombus degradation.
products references :
Amino acid sequence determination of ancrod, the thrombin-like alpha-fibrinogenase from the venom of Akistrodon rhodostoma.Burkhart W., Simth G.F.H., Su J.-L., Parikh I., Levine H. IIIFEBS Lett. 297:297-301(1992)
uniprot summary :
Thiol protease. Acts synergistically with RgpB to catalyze the maturation of fimbrial subunits, such as FimA (). Its proteolytic activity is a major factor in both periodontal tissue destruction and in evasion of host defense mechanisms (Probable).
size1 :
0.01 mg (Mammalian-Cell)
size5 :
0.02 mg (Mammalian-Cell)
size9 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Mammalian-Cell)
size14 :
0.05 mg (Baculovirus)
size17 :
0.1 mg (Baculovirus)
size19 :
0.5 mg (Baculovirus)
size20 :
1 mg (Baculovirus)